close all open/close all

CDS information : Oxzol_00030


close this sectionLocation

Organism
StrainJA3453
Entry nameOxazolomycin
Contig
Start / Stop / Direction10,076 / 7,749 / - [in whole cluster]
10,076 / 7,749 / - [in contig]
Locationcomplement(7749..10076) [in whole cluster]
complement(7749..10076) [in contig]
TypeCDS
Length2,328 bp (775 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)integral membrane protein
Gene
Gene (GenBank)
EC number
Keyword
Note
  • This ORF is not involved in oxazolomycin biosynthesis.
Note (GenBank)
  • ozm orf -4
Reference
ACC
PmId
[20406823] Oxazolomycin biosynthesis in Streptomyces albus JA3453 featuring an "acyltransferase-less" type I polyketide synthase that incorporates two distinct extender units. (J Biol Chem. , 2010)

close this sectionSequence

selected fasta
>hypothetical protein [integral membrane protein]
MLGSAERHRASASGEYGIAMAAARRRAKGVWDRFSASDPGLLRLMAGLRTVGAILLALAV
LALIGTSVTHLVAGAMTAMVATFAIQEKEVRGQAVTLALGWPVALAAIALGALLSSRVIA
GDVFFVLLIFGAVYSRRFGDRGTALGLIGFQVYFVSLFVSASVSAVPGLFLTLTVAFACS
AFVRFAVVPETPERTLRRLREAFRARLAQLVAHQIDLLEADADDVDKVLDDLRRSTARLH
EAALMIQGRLEEGTSDASAAALLQRRVADAEIAAERLGVLLLNARSAERVDTLTLHLPQA
AAPLPPRARLADDAGSALRRDLRALHLLVVRLVPDDRGTALPYVRNRLLGYREEQGLPKG
SPAIQDCFRAVGEAARAILGLRLAVDGAGDEEYDTPEAARSREEFEAEEISISGEAADAA
EEEPTGLRRPTTRAAVQVAVGSALAIVGGEFLSTQRWYWAVLTCWVVFLNTASTGEILVK
GYRRLLGTVLGVVAGVALAGAVGNHTWLAFALVLLCVFGMFFTAPLSYALMSFFVTAMLG
LLYTLLNTYSLDVLVLRVEETALGAACGIVAAVLILPVRTSHRTDEELGTVLARLRDVVS
AAVAQLSGGPPVDLVDLARDLDTALDGLRSSTKPLTHPIAPLRARRQNARYVMALLETCA
YHARSLAATAELVPSSKSVAADARLALAGRRITHNIDLIAAHVRDEETTGAIESGASIAS
MLDSGRHEVLRTGSVAFRVLRHLQRLDEGIVGLARPLGVATEIRDEKAPGGKHQP
selected fasta
>hypothetical protein [integral membrane protein]
ATGCTGGGCAGCGCCGAAAGGCACCGAGCAAGCGCAAGCGGGGAGTACGGCATCGCGATG
GCAGCGGCACGACGGAGAGCGAAGGGCGTCTGGGACCGTTTCTCGGCGTCCGACCCGGGG
CTTCTGCGCCTCATGGCGGGGCTGCGCACGGTGGGGGCGATCCTGCTCGCCCTCGCCGTG
CTCGCCCTCATCGGCACCTCGGTGACCCATCTGGTGGCGGGCGCGATGACGGCGATGGTC
GCCACCTTCGCCATCCAGGAGAAGGAGGTGCGCGGCCAGGCCGTCACGCTGGCGCTCGGC
TGGCCCGTGGCGCTCGCGGCCATCGCCCTGGGGGCGCTGCTGAGCTCCCGGGTGATCGCG
GGTGACGTCTTCTTCGTCCTGCTGATCTTCGGGGCGGTCTACTCGCGCCGGTTCGGCGAC
CGGGGCACCGCGCTCGGCCTGATCGGCTTCCAGGTCTACTTCGTCTCGCTCTTCGTGAGC
GCCTCCGTCTCCGCCGTCCCCGGCCTCTTCCTCACCCTGACCGTGGCGTTCGCGTGCAGT
GCCTTCGTGCGGTTCGCCGTGGTGCCGGAGACGCCGGAGCGCACGCTGCGGCGGTTGCGC
GAGGCGTTCCGGGCCCGCCTGGCCCAGCTGGTGGCCCACCAGATCGATCTGCTCGAAGCC
GACGCCGACGACGTGGACAAGGTCCTCGACGACCTGCGGCGGAGCACCGCACGGCTGCAC
GAGGCCGCGCTGATGATCCAGGGCCGCCTGGAGGAGGGCACGAGCGACGCCTCCGCCGCC
GCGCTGCTGCAACGCAGGGTCGCCGACGCCGAGATCGCCGCCGAGCGCCTGGGCGTCCTG
CTCCTCAACGCCCGCAGCGCCGAGCGCGTCGACACCCTCACGCTGCACCTGCCGCAGGCC
GCCGCGCCCCTGCCGCCCCGCGCGCGGCTCGCGGACGACGCCGGGTCCGCCCTGCGCAGG
GATCTGCGGGCCCTGCACCTGCTCGTGGTGCGCCTGGTGCCCGACGACCGCGGCACGGCA
CTCCCGTACGTACGCAACCGCCTGCTCGGCTACCGCGAGGAGCAGGGCCTGCCCAAGGGC
TCACCGGCGATCCAGGACTGCTTCCGCGCGGTCGGCGAGGCGGCCCGCGCCATCCTCGGG
CTGCGGCTCGCGGTGGACGGGGCGGGGGACGAGGAGTACGACACCCCGGAGGCGGCCCGC
TCCCGCGAGGAGTTCGAGGCGGAGGAGATCTCGATCTCCGGTGAGGCGGCGGACGCCGCA
GAGGAGGAACCCACCGGGCTGCGGCGCCCCACCACCAGGGCGGCGGTACAGGTGGCGGTG
GGCTCCGCGCTCGCGATCGTCGGGGGCGAGTTCCTCTCCACGCAGCGCTGGTACTGGGCC
GTCCTCACCTGCTGGGTCGTCTTCCTCAACACCGCCTCGACCGGTGAGATCCTGGTCAAG
GGCTACCGCCGGCTGCTCGGCACGGTACTCGGCGTGGTGGCGGGGGTGGCGCTCGCGGGT
GCCGTGGGGAACCACACCTGGCTCGCGTTCGCCCTCGTACTGCTCTGCGTGTTCGGCATG
TTCTTCACCGCCCCGCTGTCGTACGCGCTGATGTCCTTCTTCGTCACGGCGATGCTGGGC
CTGCTGTACACGCTGCTCAACACCTACAGCCTCGACGTCCTCGTGCTGCGCGTGGAGGAG
ACCGCGCTCGGCGCGGCCTGCGGCATCGTCGCGGCCGTGCTCATCCTCCCCGTGCGGACG
TCGCACCGCACCGACGAGGAGCTCGGCACCGTCCTCGCCCGGCTCCGTGACGTGGTGTCG
GCCGCCGTGGCCCAGCTCAGCGGCGGGCCCCCGGTCGATCTCGTGGACCTGGCCCGCGAC
CTGGACACCGCCCTCGACGGTCTGCGCAGCTCCACCAAGCCGCTGACCCACCCGATCGCC
CCGCTGCGGGCCCGGCGGCAGAACGCCCGCTATGTCATGGCGCTCCTGGAGACCTGCGCC
TACCACGCGCGTTCGCTCGCGGCGACCGCCGAGCTCGTGCCCTCCAGCAAGAGCGTCGCC
GCCGATGCCCGGCTCGCCCTCGCGGGGCGCCGCATCACCCACAACATCGACCTCATCGCG
GCGCACGTGCGCGACGAGGAGACCACCGGCGCCATCGAGTCGGGCGCGAGCATCGCCTCC
ATGCTGGACAGCGGCCGTCACGAGGTGCTGCGCACCGGTTCGGTGGCCTTCCGCGTCCTG
CGCCACCTCCAGCGCCTCGACGAGGGCATCGTCGGCCTCGCGCGACCGCTCGGGGTGGCG
ACGGAGATACGGGACGAGAAGGCCCCCGGCGGCAAGCACCAGCCGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR006726 Para-hydroxybenzoic acid efflux pump subunit AaeB/fusaric acid resistance protein (Family)
 [435-732]  6.19999999999999e-20 PF04632
PF04632   FUSC
SignalP
 [1-36]  0.111 Signal
Bacteria, Gram-positive   
 [1-1]  Signal-anchor
Eukaryota   
TMHMM
 [51-73]  Transmembrane (o-i) [94-113]  Transmembrane (i-o) [118-135]  Transmembrane (o-i) [142-161]  Transmembrane (i-o) [166-188]  Transmembrane (o-i) [435-452]  Transmembrane (i-o) [457-479]  Transmembrane (o-i) [492-514]  Transmembrane (i-o) [524-546]  Transmembrane (o-i) [553-575]  Transmembrane (i-o)
Transmembrane 10