close all open/close all

CDS information : Oxzol_00040


close this sectionLocation

Organism
StrainJA3453
Entry nameOxazolomycin
Contig
Start / Stop / Direction10,240 / 10,716 / + [in whole cluster]
10,240 / 10,716 / + [in contig]
Location10240..10716 [in whole cluster]
10240..10716 [in contig]
TypeCDS
Length477 bp (158 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative peroxiredoxin
Product (GenBank)integral membrane protein
Genebcp
Gene (GenBank)
EC number1.11.1.15
Keyword
Note
  • This ORF is not involved in oxazolomycin biosynthesis.
Note (GenBank)
  • ozm orf -3
Reference
ACC
PmId
[16707707] Utilization of the methoxymalonyl-acyl carrier protein biosynthesis locus for cloning the oxazolomycin biosynthetic gene cluster from Streptomyces albus JA3453. (J Bacteriol. , 2006)
[20406823] Oxazolomycin biosynthesis in Streptomyces albus JA3453 featuring an "acyltransferase-less" type I polyketide synthase that incorporates two distinct extender units. (J Biol Chem. , 2010)
Related Reference
ACC
P0AE52
PmId
[10644761] Thioredoxin-dependent hydroperoxide peroxidase activity of bacterioferritin comigratory protein (BCP) as a new member of the thiol-specific antioxidant protein (TSA)/Alkyl hydroperoxide peroxidase C (AhpC) family. (J Biol Chem. , 2000)

close this sectionSequence

selected fasta
>putative peroxiredoxin [integral membrane protein]
MTARVAVGDTVEDFTLPDETGVPRSLGELLDDGPVVLFFYPAALTPACTAEACHFRDLAA
EFAAAGARPVGISSDGVERQMEFTERHGLGFPLLSDPDGVVRDRFGVTRGFSLAPTKRVT
FVIGRDRTVTEVVRSELRMSAHADRALEAVRRLRESAA
selected fasta
>putative peroxiredoxin [integral membrane protein]
ATGACGGCGCGCGTGGCGGTCGGCGACACCGTCGAGGACTTCACGCTGCCGGACGAGACC
GGTGTCCCGCGCAGCCTCGGCGAACTCCTCGACGACGGCCCCGTCGTGCTCTTCTTCTAT
CCGGCGGCGCTCACCCCCGCGTGCACCGCCGAGGCCTGTCACTTCCGCGATCTGGCCGCC
GAGTTCGCCGCCGCGGGCGCGCGGCCCGTGGGGATCAGCTCCGACGGGGTCGAGCGCCAG
ATGGAGTTCACCGAGCGGCACGGCCTCGGGTTTCCGCTGCTCTCGGACCCCGACGGCGTG
GTGCGCGACCGGTTCGGCGTGACGCGGGGCTTCTCCCTCGCGCCGACGAAGCGCGTCACG
TTCGTCATCGGCCGGGACCGCACCGTCACCGAGGTGGTCCGCAGCGAGCTGCGCATGAGC
GCCCACGCCGACCGCGCCCTCGAAGCCGTGCGCCGACTGCGCGAGAGCGCGGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000866 Alkyl hydroperoxide reductase subunit C/ Thiol specific antioxidant (Domain)
 [7-131]  4.29999999999998e-29 PF00578
PF00578   AhpC-TSA
IPR012336 Thioredoxin-like fold (Domain)
 [5-155]  PS51352
PS51352   THIOREDOXIN_2
 [6-154]  4.9e-37 G3DSA:3.40.30.10
G3DSA:3.40.30.10   Thioredoxin_fold
 [1-153]  2.1000026783403e-47 SSF52833
SSF52833   Thiordxn-like_fd
SignalP
 [1-52]  0.097 Signal
Bacteria, Gram-positive   
TMHMM No significant hit