close all open/close all

CDS information : Oxzol_00050


close this sectionLocation

Organism
StrainJA3453
Entry nameOxazolomycin
Contig
Start / Stop / Direction11,754 / 10,735 / - [in whole cluster]
11,754 / 10,735 / - [in contig]
Locationcomplement(10735..11754) [in whole cluster]
complement(10735..11754) [in contig]
TypeCDS
Length1,020 bp (339 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative LacI family transcriptional regulator
Product (GenBank)transcriptional regulator
Gene
Gene (GenBank)
EC number
Keyword
Note
  • This ORF is not involved in oxazolomycin biosynthesis.
Note (GenBank)
  • ozm orf -2
Reference
ACC
PmId
[16707707] Utilization of the methoxymalonyl-acyl carrier protein biosynthesis locus for cloning the oxazolomycin biosynthetic gene cluster from Streptomyces albus JA3453. (J Bacteriol. , 2006)
[20406823] Oxazolomycin biosynthesis in Streptomyces albus JA3453 featuring an "acyltransferase-less" type I polyketide synthase that incorporates two distinct extender units. (J Biol Chem. , 2010)
Family/Domain
FD
IPR000843

close this sectionSequence

selected fasta
>putative LacI family transcriptional regulator [transcriptional regulator]
MADVTLKDVARASGCSIATVSRVLAGTRPVGAETARRVREAAAALGYRPNHAARALRSRA
TGTVGLVLPQITNPFYPALVRELTHALHADGRAVLLADCDDDPAAEAEHIADLLGRRVDA
LLVIPADEERSRAAVAAAAARVPLVLMDRGCGPGVADSVAVDNGAGMALVLEHLAATGRR
AVCFVGAEGTVSAAAERRGAYAAGAGALDPGAPGRVVLGDFSVEWGRAAVDQVWAARPDA
LVCANDLIAIGALQRLQQLGADVPGEVAVTGFDDIPMAALSAPGVTTVRQPVAQLAAEAA
RLLAQRLAGDAGPQRAIRLAPELVVRESSAPKRAARTPA
selected fasta
>putative LacI family transcriptional regulator [transcriptional regulator]
GTGGCCGACGTAACGCTGAAGGACGTGGCCCGGGCCTCCGGCTGTTCCATCGCCACGGTC
TCCCGGGTCCTCGCGGGCACCCGCCCCGTCGGCGCCGAGACCGCCCGCCGCGTCCGCGAG
GCCGCGGCGGCGCTCGGCTACCGGCCCAACCACGCGGCCCGCGCCCTGCGCAGCCGCGCG
ACGGGCACGGTCGGTCTCGTCCTGCCGCAGATCACCAACCCCTTCTACCCGGCCCTCGTA
CGGGAGTTGACGCACGCCCTGCACGCGGACGGCCGGGCGGTGCTGCTCGCCGACTGCGAC
GACGACCCGGCGGCCGAGGCCGAGCACATCGCCGACCTGCTCGGCCGCCGGGTCGACGCC
CTCCTGGTGATCCCCGCGGACGAGGAGCGCAGCCGGGCGGCGGTGGCCGCGGCGGCGGCC
CGGGTGCCGCTCGTCCTGATGGACCGCGGCTGCGGCCCCGGGGTCGCCGACTCCGTCGCG
GTCGACAACGGCGCGGGCATGGCCCTCGTACTGGAGCACCTGGCCGCCACGGGCCGCCGC
GCCGTCTGCTTCGTCGGGGCCGAGGGGACGGTGTCGGCGGCGGCCGAGCGGCGCGGCGCC
TACGCGGCCGGGGCCGGCGCCCTCGACCCGGGCGCGCCGGGGCGGGTGGTGCTCGGCGAC
TTCTCCGTGGAGTGGGGGCGCGCCGCCGTCGACCAGGTGTGGGCGGCCCGGCCCGACGCT
CTGGTCTGCGCCAACGACCTCATCGCCATAGGGGCCCTGCAACGGCTCCAGCAGCTCGGC
GCGGACGTGCCCGGTGAGGTGGCCGTCACCGGCTTCGACGACATCCCGATGGCGGCGCTC
TCCGCGCCCGGCGTCACGACGGTCCGCCAGCCCGTGGCCCAGCTCGCCGCCGAGGCCGCG
CGGCTCCTGGCCCAGCGCCTCGCCGGCGACGCGGGACCGCAGCGGGCCATACGGCTCGCG
CCCGAACTGGTCGTACGGGAGTCGAGCGCCCCGAAGCGGGCGGCACGCACCCCGGCGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000843 Transcription regulator HTH, LacI (Domain)
 [3-73]  4.40000933643891e-28 SM00354
SM00354   HTH_LACI
 [5-50]  3.4e-15 PF00356
PF00356   LacI
 [4-58]  PS50932
PS50932   HTH_LACI_2
IPR010982 Lambda repressor-like, DNA-binding domain (Domain)
 [1-62]  2.60000517657733e-18 SSF47413
SSF47413   Lambda_like_DNA
 [4-64]  2.2e-22 G3DSA:1.10.260.40
G3DSA:1.10.260.40   G3DSA:1.10.260.40
SignalP
 [1-32]  0.386 Signal
Bacteria, Gram-positive   
 [1-25]  0.25 Signal
Bacteria, Gram-negative   
TMHMM No significant hit