close all open/close all

CDS information : Oxzol_00060


close this sectionLocation

Organism
StrainJA3453
Entry nameOxazolomycin
Contig
Start / Stop / Direction12,020 / 12,967 / + [in whole cluster]
12,020 / 12,967 / + [in contig]
Location12020..12967 [in whole cluster]
12020..12967 [in contig]
TypeCDS
Length948 bp (315 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative ribonucleoside hydrolase
Product (GenBank)nucleoside hydrolase
Gene
Gene (GenBank)
EC number
Keyword
Note
  • This ORF is not involved in oxazolomycin biosynthesis.
Note (GenBank)
  • ozm orf -1
Reference
ACC
PmId
[16707707] Utilization of the methoxymalonyl-acyl carrier protein biosynthesis locus for cloning the oxazolomycin biosynthetic gene cluster from Streptomyces albus JA3453. (J Bacteriol. , 2006)
[20406823] Oxazolomycin biosynthesis in Streptomyces albus JA3453 featuring an "acyltransferase-less" type I polyketide synthase that incorporates two distinct extender units. (J Biol Chem. , 2010)
Related Reference
ACC
Q53AQ5
PmId
[16549679] Genes encoding ribonucleoside hydrolase 1 and 2 from Corynebacterium ammoniagenes. (Microbiology. , 2006)

close this sectionSequence

selected fasta
>putative ribonucleoside hydrolase [nucleoside hydrolase]
MPRKIILDCDPGHDDAIAMLLAHGNPDVELVAVTTVVGNQTLEKVTRNALSVARIANITG
VPFAAGCSRPLIRTVETAPDIHGESGIDGPVMPEPTLALDDRHAVDLIIETVMAHEPGEI
TIVPTAGLTNIALAARKEPRIVERVREVVLMGGGYHTGNWSPVAEFNIKIDPEAAHIVFN
EPWPVTMVGLDLTHQALATPEVVERIAKVGTGPAVFVTELLDFFGAMYLQAQGFDAPPVH
DPCAVAYVIDPDVMTVRKAPVDIELTGTLTLGMTVTDLRAPAPADCHTQVAVDLDHQRFW
DLVVDAVERIGDVRA
selected fasta
>putative ribonucleoside hydrolase [nucleoside hydrolase]
ATGCCCCGAAAGATCATCCTGGACTGCGACCCCGGACATGACGACGCGATCGCCATGCTC
CTCGCGCACGGAAACCCGGATGTCGAGCTGGTCGCCGTCACCACCGTGGTGGGCAACCAG
ACCCTGGAGAAGGTCACCCGCAACGCCCTGTCGGTGGCCCGCATCGCGAACATCACCGGC
GTACCCTTCGCGGCCGGCTGCTCCCGCCCCCTGATCCGCACCGTGGAGACCGCCCCCGAC
ATCCACGGCGAGAGCGGCATCGACGGCCCCGTCATGCCCGAGCCGACCCTGGCCCTTGAC
GACCGCCACGCCGTGGACCTGATCATCGAGACGGTCATGGCGCACGAGCCCGGCGAGATC
ACCATCGTGCCCACCGCGGGCCTGACGAACATCGCCCTGGCCGCGCGCAAGGAGCCCCGC
ATCGTCGAGCGCGTCCGCGAGGTCGTCCTGATGGGCGGCGGTTACCACACGGGCAACTGG
AGCCCCGTCGCCGAGTTCAACATCAAGATCGACCCCGAGGCCGCGCACATCGTCTTCAAC
GAGCCCTGGCCGGTCACCATGGTCGGCCTCGACCTGACCCACCAGGCCCTCGCCACCCCC
GAGGTCGTCGAGCGCATCGCGAAGGTCGGCACCGGGCCCGCCGTCTTCGTCACCGAGCTC
CTGGACTTCTTCGGCGCCATGTACCTCCAGGCCCAGGGCTTCGACGCGCCGCCGGTCCAC
GACCCGTGCGCGGTCGCCTACGTCATCGACCCCGACGTCATGACCGTCCGCAAGGCCCCC
GTGGACATCGAGCTCACCGGCACCCTCACCCTCGGCATGACCGTGACGGACCTCCGCGCG
CCCGCCCCCGCCGACTGCCACACCCAGGTCGCCGTCGACCTCGACCACCAGCGGTTCTGG
GACCTCGTCGTGGACGCCGTCGAGCGGATCGGGGACGTCCGCGCATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001910 Inosine/uridine-preferring nucleoside hydrolase domain (Domain)
 [2-309]  3.90000000000001e-99 PF01156
PF01156   IU_nuc_hydro
 [1-310]  1.39999999999997e-123 G3DSA:3.90.245.10
G3DSA:3.90.245.10   I/U_nuclsd_hydro
 [2-313]  2.1000026783403e-109 SSF53590
SSF53590   I/U_nuclsd_hydro
IPR015910 Inosine/uridine-preferring nucleoside hydrolase, conserved site (Conserved_site)
 [8-18]  PS01247
PS01247   IUNH
SignalP No significant hit
TMHMM No significant hit