close all open/close all

CDS information : Oxzol_00070


close this sectionLocation

Organism
StrainJA3453
Entry nameOxazolomycin
Contig
Start / Stop / Direction12,964 / 14,412 / + [in whole cluster]
12,964 / 14,412 / + [in contig]
Location12964..14412 [in whole cluster]
12964..14412 [in contig]
TypeCDS
Length1,449 bp (482 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.3 transport
Productputative major facilitator superfamily transporter
Product (GenBank)transmembrane efflux protein
Gene
Gene (GenBank)ozmA
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[20406823] Oxazolomycin biosynthesis in Streptomyces albus JA3453 featuring an "acyltransferase-less" type I polyketide synthase that incorporates two distinct extender units. (J Biol Chem. , 2010)
Family/Domain
FD
IPR011701

close this sectionSequence

selected fasta
>putative major facilitator superfamily transporter [transmembrane efflux protein]
MNARTEPAAAPGGARGSRPVRVGVLVTALLAACFAFQLNASMLSPALKNIEDSLGATSAE
IGLTQTAFFTSAALFSLFLPRLGDLVGRRKVLGGMLALMVVGCVVAAFAENVPMLFVGRV
IQGVSGPTVPLCLIMLRNEVHEPKRYGTLLGVITAVNGGIAGVDSLAGGYLADHHGFQSV
FWAMAGVAALATVLVATLTPESKAADTADSRMDWPGVTLLVISVGAALIALNEAGKLGAA
NWPLVIGLFVVTAIAFALFWRTEDRSSHPLVATRHLRRRSTWALLLTTVLTMTGVFAVMN
GMIPAFAQDARAGFGMSAEQSAWWTLTPYALAGLAMGPVAGRLAATYGYGRILRLGLIGS
AVTVALMLVTLHGDSRPLLLAASVLIGVTYAGVGNIVLNGLGIVLSPKENPGFLPGLNAG
AFNLGAGLSFAVLYAVQTAAEPADKTSPAGYTAGMIAGVVLIAAGFATSFLIPKPVEAEA
TE
selected fasta
>putative major facilitator superfamily transporter [transmembrane efflux protein]
ATGAACGCCCGCACCGAACCCGCCGCCGCCCCCGGCGGCGCCCGCGGCTCCCGGCCGGTC
CGCGTCGGCGTCCTGGTCACCGCGCTCCTGGCGGCCTGCTTCGCCTTCCAGCTCAACGCG
AGCATGCTCAGCCCGGCCCTGAAGAACATCGAGGACTCCCTCGGGGCGACCTCCGCCGAG
ATCGGCCTGACCCAGACCGCGTTCTTCACCTCCGCGGCCCTCTTCTCGCTCTTCCTGCCG
CGCCTCGGCGACCTCGTCGGACGGCGCAAGGTGCTCGGAGGGATGCTGGCGCTCATGGTC
GTCGGCTGTGTGGTCGCGGCGTTCGCGGAGAACGTCCCCATGCTCTTCGTCGGCCGTGTC
ATCCAGGGCGTCTCCGGACCCACCGTGCCGCTCTGCCTGATCATGCTGCGCAACGAAGTG
CACGAGCCGAAGAGGTACGGCACCCTCCTCGGCGTCATCACCGCCGTCAACGGCGGCATC
GCCGGCGTCGACTCCCTGGCCGGCGGCTACCTCGCCGACCACCACGGCTTCCAGTCGGTG
TTCTGGGCGATGGCCGGCGTGGCCGCGCTCGCCACCGTGCTCGTCGCCACCCTCACCCCG
GAGTCCAAGGCCGCCGACACCGCCGACAGCCGGATGGACTGGCCCGGTGTCACCCTCCTG
GTGATCTCCGTCGGCGCCGCCCTCATCGCGCTCAACGAAGCGGGCAAGCTCGGCGCGGCG
AACTGGCCGCTGGTCATCGGGCTCTTCGTCGTCACGGCCATCGCCTTCGCCCTCTTCTGG
CGCACCGAGGACCGCAGCAGCCACCCGCTGGTCGCCACCCGCCATCTGCGCCGGCGCTCC
ACCTGGGCACTCCTGCTCACCACCGTCCTGACCATGACGGGCGTCTTCGCCGTGATGAAC
GGCATGATCCCCGCCTTCGCCCAGGACGCCCGGGCGGGCTTCGGCATGAGCGCCGAGCAG
TCCGCCTGGTGGACCCTGACCCCGTACGCCCTCGCGGGCCTGGCCATGGGCCCCGTCGCC
GGGCGGCTGGCCGCCACGTACGGCTACGGCCGCATCCTGCGCCTCGGCCTCATCGGCTCG
GCCGTGACGGTGGCCCTGATGCTGGTCACCCTGCACGGCGACTCGCGGCCGCTGCTCCTG
GCCGCGTCGGTCCTCATCGGCGTCACCTACGCGGGCGTGGGCAACATCGTCCTCAACGGC
CTCGGCATCGTGCTCTCCCCGAAGGAGAACCCGGGCTTCCTGCCGGGACTGAACGCGGGC
GCCTTCAACCTCGGCGCGGGCCTCAGCTTCGCCGTCCTCTACGCCGTGCAGACCGCCGCG
GAACCGGCCGACAAGACCTCGCCCGCCGGCTACACGGCAGGCATGATCGCCGGTGTCGTC
CTCATCGCGGCGGGCTTCGCCACGTCCTTCCTCATCCCCAAGCCGGTGGAGGCGGAAGCC
ACGGAGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR011701 Major facilitator superfamily (Family)
 [30-429]  1.9e-43 PF07690
PF07690   MFS_1
IPR016196 Major facilitator superfamily domain, general substrate transporter (Domain)
 [1-482]  4.10001399699315e-56 SSF103473
SSF103473   MFS_gen_substrate_transporter
IPR020846 Major facilitator superfamily domain (Domain)
 [25-476]  PS50850
PS50850   MFS
SignalP
 [1-35]  0.924 Signal
Eukaryota   
 [1-40]  0.51 Signal
Bacteria, Gram-negative   
 [1-40]  0.519 Signal
Bacteria, Gram-positive   
TMHMM
 [20-42]  Transmembrane (i-o) [57-79]  Transmembrane (o-i) [91-109]  Transmembrane (i-o) [114-136]  Transmembrane (o-i) [148-170]  Transmembrane (i-o) [180-202]  Transmembrane (o-i) [214-231]  Transmembrane (i-o) [241-260]  Transmembrane (o-i) [281-303]  Transmembrane (i-o) [323-345]  Transmembrane (o-i) [352-369]  Transmembrane (i-o) [384-406]  Transmembrane (o-i) [413-435]  Transmembrane (i-o) [450-472]  Transmembrane (o-i)
Transmembrane 14