close all open/close all

CDS information : Oxzol_00080


close this sectionLocation

Organism
StrainJA3453
Entry nameOxazolomycin
Contig
Start / Stop / Direction15,549 / 14,449 / - [in whole cluster]
15,549 / 14,449 / - [in contig]
Locationcomplement(14449..15549) [in whole cluster]
complement(14449..15549) [in contig]
TypeCDS
Length1,101 bp (366 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.1 modification addition of extender units
Productglyceroyl-ACP biosynthesis protein
1,3-bisphospho-D-glycerate phosphatase/glyceroyltransferase
Product (GenBank)glyceroyl transferase/phosphatase
Gene
Gene (GenBank)ozmB
EC number
Keyword
  • methoxymalonyl-ACP
Note
Note (GenBank)
Reference
ACC
PmId
[16707707] Utilization of the methoxymalonyl-acyl carrier protein biosynthesis locus for cloning the oxazolomycin biosynthetic gene cluster from Streptomyces albus JA3453. (J Bacteriol. , 2006)
[16895402] The bifunctional glyceryl transferase/phosphatase OzmB belonging to the HAD superfamily that diverts 1,3-bisphosphoglycerate into polyketide biosynthesis. (J Am Chem Soc. , 2006)
[20406823] Oxazolomycin biosynthesis in Streptomyces albus JA3453 featuring an "acyltransferase-less" type I polyketide synthase that incorporates two distinct extender units. (J Biol Chem. , 2010)
Related Reference
ACC
Q8KUG4
NITE
Ansam_00180
PmId
[11996558] Functional expression of genes involved in the biosynthesis of the novel polyketide chain extension unit, methoxymalonyl-acyl carrier protein, and engineered biosynthesis of 2-desmethyl-2-methoxy-6-deoxyerythronolide B. (J Am Chem Soc. , 2002)
[17076505] On the biosynthetic origin of methoxymalonyl-acyl carrier protein, the substrate for incorporation of "glycolate" units into ansamitocin and soraphen A. (J Am Chem Soc. , 2006)

close this sectionSequence

selected fasta
>glyceroyl-ACP biosynthesis protein [glyceroyl transferase/phosphatase]
MKRVTEARPTIKCLVWDLDNTLWRGTLVEDGEVVLHEGLREVIVELDSRGILQAIASRND
HDHAWALLEKLGIAEYFVLPRINWGAKSASVRAIADELNFAPSTIAFIDDQPAERAEVAF
HLPEVRCYPAEEALGLPGLAEFTPAAVTGDARRRRQMYQAGVRREAERTEHVGTDEEFLR
SLGLELRIERAGDEAISRVEELTLRTSQMNATGVHYSDRALRGLVADEEHEVLVASLVDR
FGPHGAIGVILLERRPRSWHIKLLATSCRVVSFGVGAALLRWLSDEAARAGVLLTAGFRR
TERNRMMEVAYRFAGFREHTEGAAEEGGVQTLAMEPVRQDAPAHLAVLAPRLFDASPGLV
EWAHAE
selected fasta
>glyceroyl-ACP biosynthesis protein [glyceroyl transferase/phosphatase]
GTGAAGCGGGTGACCGAAGCACGGCCGACGATCAAATGCCTGGTCTGGGACCTGGACAAC
ACGCTGTGGCGCGGCACGCTGGTGGAGGACGGCGAGGTCGTCCTCCACGAGGGCCTGCGC
GAGGTGATCGTCGAACTGGACTCGCGCGGCATCCTCCAGGCGATCGCCAGCCGGAACGAC
CACGACCACGCCTGGGCGCTCCTGGAGAAGCTCGGGATCGCCGAGTACTTCGTGCTGCCG
CGCATCAACTGGGGCGCCAAGTCGGCCTCCGTACGGGCCATCGCCGACGAGCTGAACTTC
GCGCCGTCGACGATCGCCTTCATCGACGACCAGCCCGCCGAGCGCGCGGAGGTGGCGTTC
CATCTGCCCGAGGTGCGCTGCTACCCGGCGGAGGAGGCCTTGGGCCTGCCCGGGCTCGCG
GAGTTCACCCCGGCCGCCGTCACCGGCGACGCGCGCAGACGGCGGCAGATGTACCAGGCC
GGAGTGCGGCGGGAGGCGGAGCGCACCGAGCACGTCGGCACCGACGAGGAGTTCCTGCGC
TCGCTCGGCCTGGAGCTGCGCATCGAGCGCGCCGGTGACGAGGCGATCTCCCGGGTCGAG
GAGCTGACCCTGCGCACCAGCCAGATGAACGCGACGGGCGTGCACTACAGCGACCGTGCC
CTGCGCGGACTGGTGGCCGACGAGGAGCACGAGGTGCTCGTCGCCTCGCTCGTCGACCGC
TTCGGCCCGCACGGCGCGATCGGCGTGATCCTGCTGGAGCGGCGTCCGCGCTCCTGGCAC
ATCAAGCTGCTCGCGACCTCGTGCCGCGTGGTGTCCTTCGGGGTGGGGGCGGCGCTGCTG
CGCTGGCTCTCCGACGAGGCCGCCCGGGCGGGGGTCCTGCTGACCGCGGGGTTCCGGCGC
ACCGAACGCAATCGCATGATGGAGGTCGCCTACCGCTTCGCGGGTTTTCGGGAGCACACG
GAAGGGGCGGCGGAGGAGGGCGGTGTGCAGACGCTGGCCATGGAACCCGTCCGGCAGGAC
GCCCCCGCTCATCTGGCCGTGCTGGCGCCGCGCCTGTTCGATGCCTCACCCGGGCTCGTC
GAGTGGGCGCACGCCGAGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR010033 HAD-superfamily phosphatase, subfamily IIIC (Domain)
 [12-121]  5.40000000000002e-19 TIGR01681
TIGR01681   HAD-SF-IIIC
IPR010037 FkbH domain (Domain)
 [9-318]  3.39999999999996e-109 TIGR01686
TIGR01686   FkbH
IPR016181 Acyl-CoA N-acyltransferase (Domain)
 [187-321]  2e-07 G3DSA:3.40.630.30
G3DSA:3.40.630.30   Acyl_CoA_acyltransferase
IPR023214 HAD-like domain (Domain)
 [11-113]  6.1e-12 G3DSA:3.40.50.1000
G3DSA:3.40.50.1000   HAD-like_dom
 [8-145]  1.10000150671642e-17 SSF56784
SSF56784   HAD-like_dom
SignalP No significant hit
TMHMM No significant hit