close all open/close all

CDS information : Oxzol_00090


close this sectionLocation

Organism
StrainJA3453
Entry nameOxazolomycin
Contig
Start / Stop / Direction16,523 / 15,546 / - [in whole cluster]
16,523 / 15,546 / - [in contig]
Locationcomplement(15546..16523) [in whole cluster]
complement(15546..16523) [in contig]
TypeCDS
Length978 bp (325 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.1 modification addition of extender units
Productputative acyltransferase
Product (GenBank)OzmC
Gene
Gene (GenBank)ozmC
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[16707707] Utilization of the methoxymalonyl-acyl carrier protein biosynthesis locus for cloning the oxazolomycin biosynthetic gene cluster from Streptomyces albus JA3453. (J Bacteriol. , 2006)
[20406823] Oxazolomycin biosynthesis in Streptomyces albus JA3453 featuring an "acyltransferase-less" type I polyketide synthase that incorporates two distinct extender units. (J Biol Chem. , 2010)
Family/Domain
FD
IPR013747

close this sectionSequence

selected fasta
>putative acyltransferase [OzmC]
MTTAAGDIGIGAIHCLLPDERVAVADLPELARLTDEELRFAEQAGIKEVGVFPDTEPTEL
AARACRELLAAHPGVPDLMLHIGSRAPDVLIGSDSGKIAHLAGLTGVFPFTVDGLGCAGS
SAAWGLGRDLLRGDPSRESVLLTYGSRPTAADRVRRPVTVIGDGAFAMTLVRGGRPLLRA
HRMEADSSFHDLFKVEYKNSPWSQWREVCDDNDRYSFELAMHSRTRLSKLVDQVLADAGI
GKDDVAATLMQNVTSSAFDFYKATLGLPIHPVCATHLAELGHLGPMDVVLNLDRLLATGE
VGPGGHVLVLSNSPVAAWTVTLWEV
selected fasta
>putative acyltransferase [OzmC]
ATGACGACGGCTGCCGGAGACATCGGAATAGGCGCGATCCACTGCTTGCTGCCCGACGAG
CGCGTGGCCGTCGCCGACCTGCCCGAGCTGGCCAGGCTCACCGACGAGGAGCTGAGGTTC
GCCGAGCAGGCCGGGATCAAGGAGGTCGGTGTCTTCCCCGACACCGAGCCGACCGAACTG
GCGGCGCGGGCCTGCCGGGAACTGCTCGCCGCGCATCCGGGCGTCCCCGACCTGATGCTG
CACATCGGCTCCCGGGCACCGGACGTGCTGATCGGCTCGGACTCGGGCAAGATCGCCCAC
CTGGCCGGGCTCACCGGCGTCTTCCCCTTCACCGTCGACGGCCTGGGCTGTGCGGGCTCC
TCCGCCGCCTGGGGCCTCGGCAGGGACCTGCTCCGCGGCGATCCGTCGCGGGAGAGCGTC
CTGCTCACCTACGGCAGCCGCCCCACCGCCGCCGACCGGGTCCGCCGTCCCGTCACGGTG
ATCGGGGACGGCGCGTTCGCCATGACGCTGGTGCGCGGCGGCCGGCCGCTGCTCCGGGCG
CACCGCATGGAGGCGGACAGCTCCTTCCACGACCTGTTCAAGGTCGAGTACAAGAACAGC
CCCTGGTCGCAGTGGCGCGAGGTGTGCGACGACAACGACCGCTACTCCTTCGAACTGGCC
ATGCACAGCCGCACCAGGCTGAGCAAGCTCGTCGACCAGGTACTCGCGGACGCGGGCATC
GGCAAGGACGACGTGGCCGCCACCCTGATGCAGAACGTCACCTCCAGCGCCTTCGACTTC
TACAAGGCCACGCTGGGGCTGCCGATCCACCCGGTCTGCGCCACCCACCTCGCGGAGCTC
GGCCACCTCGGCCCGATGGACGTGGTCCTGAACCTGGACCGCCTCCTCGCCACCGGTGAG
GTCGGACCCGGTGGACACGTCCTCGTCCTGAGCAACAGCCCGGTCGCCGCGTGGACGGTG
ACCCTGTGGGAGGTGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR013747 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III C-terminal (Domain)
 [235-323]  4.80000000000001e-08 PF08541
PF08541   ACP_syn_III_C
IPR016038 Thiolase-like, subgroup (Domain)
 [6-164]  8.80000000000003e-15 G3DSA:3.40.47.10 [165-324]  2.1e-11 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [12-325]  1.99999636034521e-19 SSF53901
SSF53901   Thiolase-like
SignalP
 [1-25]  0.053 Signal
Bacteria, Gram-negative   
TMHMM No significant hit