close all open/close all

CDS information : Oxzol_00110


close this sectionLocation

Organism
StrainJA3453
Entry nameOxazolomycin
Contig
Start / Stop / Direction17,894 / 17,613 / - [in whole cluster]
17,894 / 17,613 / - [in contig]
Locationcomplement(17613..17894) [in whole cluster]
complement(17613..17894) [in contig]
TypeCDS
Length282 bp (93 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.1 modification addition of extender units
Productputative acyl carrier protein
Product (GenBank)acyl carrier protein
Gene
Gene (GenBank)ozmE
EC number
Keyword
  • methoxymalonyl-ACP
Note
Note (GenBank)
Reference
ACC
PmId
[16707707] Utilization of the methoxymalonyl-acyl carrier protein biosynthesis locus for cloning the oxazolomycin biosynthetic gene cluster from Streptomyces albus JA3453. (J Bacteriol. , 2006)
[20406823] Oxazolomycin biosynthesis in Streptomyces albus JA3453 featuring an "acyltransferase-less" type I polyketide synthase that incorporates two distinct extender units. (J Biol Chem. , 2010)
Related Reference
ACC
Q8KUG2
NITE
Ansam_00160
PmId
[11960423] Identification of a set of genes involved in the formation of the substrate for the incorporation of the unusual "glycolate" chain extension unit in ansamitocin biosynthesis. (J Am Chem Soc. , 2002)
[11996558] Functional expression of genes involved in the biosynthesis of the novel polyketide chain extension unit, methoxymalonyl-acyl carrier protein, and engineered biosynthesis of 2-desmethyl-2-methoxy-6-deoxyerythronolide B. (J Am Chem Soc. , 2002)
Family/Domain
FD
IPR009081

close this sectionSequence

selected fasta
>putative acyl carrier protein [acyl carrier protein]
MSEHTTTPPLSAEHVRTELKRFLEERTKTDWAADTDLFATGGVSSLFAMELVVHVEKTFG
IAVEGPDLRIDNFRTVDAMTALVLRLAEAGSGE
selected fasta
>putative acyl carrier protein [acyl carrier protein]
ATGAGCGAGCACACCACCACCCCTCCCCTGTCGGCGGAGCACGTGCGAACCGAGCTGAAG
CGGTTCCTGGAGGAGCGCACCAAGACCGACTGGGCGGCGGACACCGACCTCTTCGCGACC
GGCGGTGTCTCCTCCCTCTTCGCGATGGAGCTGGTGGTCCACGTCGAGAAGACCTTCGGT
ATCGCCGTCGAGGGACCCGACCTGCGCATCGACAACTTCCGTACGGTGGACGCCATGACC
GCTCTGGTGCTCCGGCTCGCCGAGGCCGGCTCCGGTGAGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR009081 Acyl carrier protein-like (Domain)
 [13-85]  2.5e-13 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [11-87]  2.00000075217456e-12 SSF47336
SSF47336   ACP_like
 [15-83]  3.1e-07 PF00550
PF00550   PP-binding
 [15-84]  PS50075
PS50075   ACP_DOMAIN
SignalP No significant hit
TMHMM No significant hit