close all open/close all

CDS information : Oxzol_00120


close this sectionLocation

Organism
StrainJA3453
Entry nameOxazolomycin
Contig
Start / Stop / Direction18,574 / 17,909 / - [in whole cluster]
18,574 / 17,909 / - [in contig]
Locationcomplement(17909..18574) [in whole cluster]
complement(17909..18574) [in contig]
TypeCDS
Length666 bp (221 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.1 modification addition of extender units
Productputative O-methyltransferase
Product (GenBank)o-methyltransferase
Gene
Gene (GenBank)ozmF
EC number2.1.1.-
Keyword
  • methoxymalonyl-ACP
Note
Note (GenBank)
Reference
ACC
PmId
[16707707] Utilization of the methoxymalonyl-acyl carrier protein biosynthesis locus for cloning the oxazolomycin biosynthetic gene cluster from Streptomyces albus JA3453. (J Bacteriol. , 2006)
[20406823] Oxazolomycin biosynthesis in Streptomyces albus JA3453 featuring an "acyltransferase-less" type I polyketide synthase that incorporates two distinct extender units. (J Biol Chem. , 2010)
Related Reference
ACC
Q8KUG5
NITE
Ansam_00190
PmId
[11996558] Functional expression of genes involved in the biosynthesis of the novel polyketide chain extension unit, methoxymalonyl-acyl carrier protein, and engineered biosynthesis of 2-desmethyl-2-methoxy-6-deoxyerythronolide B. (J Am Chem Soc. , 2002)
ACC
P28034
PmId
[1894629] Molecular cloning, induction and taxonomic distribution of caffeoyl-CoA 3-O-methyltransferase, an enzyme involved in disease resistance. (J Biol Chem. , 1991)
[9037150] Structure of the parsley caffeoyl-CoA O-methyltransferase gene, harbouring a novel elicitor responsive cis-acting element. (Plant Mol Biol. , 1997)
Family/Domain
FD
IPR002935

close this sectionSequence

selected fasta
>putative O-methyltransferase [o-methyltransferase]
MAGQLSLDEPLLDYVRQMSLRDDDVLRDLRAETAGMPMLRAMLVLPEEAQLLALLVRVTG
ARNVLEVGTFTGYSSLCMARALPPGGRVVTCDISERWTAVARRYWERAGVDGLIDLRLGD
AAETLDTLCAQDGPGGFDLAFVDADKANYLRYYEQSLALVRPGGLLVLDNTLFFGKVVDP
AAQDPDTLAIRELNTLLRDDERVDLSMLAVADGLTLVHKKP
selected fasta
>putative O-methyltransferase [o-methyltransferase]
ATGGCGGGACAGCTCTCACTCGACGAGCCGCTCCTCGACTACGTACGGCAGATGTCGCTG
CGCGACGACGACGTGCTGCGCGACCTGCGCGCCGAGACCGCGGGCATGCCCATGCTCCGG
GCGATGCTGGTCCTGCCCGAAGAGGCACAGCTCCTCGCGCTCCTCGTACGGGTCACCGGG
GCGCGGAACGTCCTGGAGGTCGGCACCTTCACCGGCTACAGCAGCCTGTGCATGGCACGC
GCCCTGCCGCCCGGCGGCCGGGTCGTCACCTGCGACATCAGCGAGCGCTGGACGGCCGTC
GCCCGGCGCTACTGGGAGCGGGCCGGGGTCGACGGGCTGATCGACCTGCGGCTCGGGGAC
GCCGCGGAGACGCTCGACACCCTGTGCGCGCAGGACGGCCCCGGCGGCTTCGACCTGGCC
TTCGTCGACGCGGACAAGGCCAACTACCTCCGTTACTACGAGCAGTCGCTCGCCCTGGTC
CGCCCCGGCGGACTGCTCGTCCTCGACAACACCCTCTTCTTCGGCAAGGTCGTCGACCCC
GCCGCGCAGGACCCGGACACCCTGGCCATCCGTGAACTCAACACCCTGCTGCGGGATGAC
GAGCGCGTGGACCTCTCCATGCTCGCCGTCGCCGACGGCCTCACCCTCGTCCACAAGAAG
CCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002935 O-methyltransferase, family 3 (Family)
 [17-219]  9.60000000000004e-83 PF01596
PF01596   Methyltransf_3
SignalP No significant hit
TMHMM No significant hit