close all open/close all

CDS information : Oxzol_00130


close this sectionLocation

Organism
StrainJA3453
Entry nameOxazolomycin
Contig
Start / Stop / Direction19,437 / 18,574 / - [in whole cluster]
19,437 / 18,574 / - [in contig]
Locationcomplement(18574..19437) [in whole cluster]
complement(18574..19437) [in contig]
TypeCDS
Length864 bp (287 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.1 modification addition of extender units
Productputative oxidoreductase
Product (GenBank)glyceroyl ACP dehydrogenase
Gene
Gene (GenBank)ozmG
EC number
Keyword
  • methoxymalonyl-ACP
Note
Note (GenBank)
Reference
ACC
PmId
[16707707] Utilization of the methoxymalonyl-acyl carrier protein biosynthesis locus for cloning the oxazolomycin biosynthetic gene cluster from Streptomyces albus JA3453. (J Bacteriol. , 2006)
[20406823] Oxazolomycin biosynthesis in Streptomyces albus JA3453 featuring an "acyltransferase-less" type I polyketide synthase that incorporates two distinct extender units. (J Biol Chem. , 2010)
Related Reference
ACC
Q8KUG1
NITE
Ansam_00150
PmId
[11996558] Functional expression of genes involved in the biosynthesis of the novel polyketide chain extension unit, methoxymalonyl-acyl carrier protein, and engineered biosynthesis of 2-desmethyl-2-methoxy-6-deoxyerythronolide B. (J Am Chem Soc. , 2002)
ACC
Q9ADL9
NITE
Soraph_00040
PmId
[12039053] Characterization of the biosynthetic gene cluster for the antifungal polyketide soraphen A from Sorangium cellulosum So ce26. (Gene. , 2002)
[15289572] Heterologous production of the antifungal polyketide antibiotic soraphen A of Sorangium cellulosum So ce26 in Streptomyces lividans. (Microbiology. , 2004)
ACC
Q7BQ74
PmId
[16983083] Hydroxymalonyl-acyl carrier protein (ACP) and aminomalonyl-ACP are two additional type I polyketide synthase extender units. (Proc Natl Acad Sci U S A. , 2006)

close this sectionSequence

selected fasta
>putative oxidoreductase [glyceroyl ACP dehydrogenase]
MTEEHPTPRLAVLGAGVMGVGITTLALGQGVPVVLVETDPAKRADAPARVERELRTAQLM
GVRSGAPRAELVTAARPADCAGADVVIEAITEDAGLKAAALTEVSEAVGEDTALVTNTSS
IPVDELAAKLPRPEDLLGVHFMNPSYLIRTVEVIRGSRTSARAVDSVTRLLTALGRRGVL
VGDGPGFVTSRVLHRMINDAARIVQEGRASAEDVDTLMQDCLGHRTGPLRTADLIGIDNL
VDSLRVLHERTGDEGCRPCELLLQKVRDGEHGRKSGQGFYTYTGVVS
selected fasta
>putative oxidoreductase [glyceroyl ACP dehydrogenase]
GTGACAGAGGAACATCCCACCCCACGGCTGGCCGTTCTGGGCGCCGGTGTCATGGGGGTC
GGCATCACCACACTCGCTCTCGGTCAGGGCGTCCCGGTGGTCCTGGTCGAAACCGATCCG
GCGAAGCGCGCGGACGCCCCGGCCAGGGTCGAGCGCGAACTGCGCACGGCCCAGCTCATG
GGCGTCCGCTCCGGCGCCCCCCGCGCCGAGCTGGTCACCGCCGCCCGGCCGGCGGACTGC
GCGGGCGCGGACGTGGTGATCGAGGCGATCACCGAGGACGCCGGCCTGAAGGCCGCGGCG
CTGACCGAGGTGAGCGAAGCCGTCGGTGAGGACACCGCCCTGGTCACCAACACCTCCTCC
ATCCCGGTGGACGAGCTCGCGGCGAAGCTCCCGCGCCCCGAGGACCTGCTCGGCGTCCAC
TTCATGAACCCCTCGTACCTGATCCGCACGGTCGAGGTGATCCGCGGCTCGCGGACCTCG
GCACGGGCCGTGGACTCCGTCACCAGGCTCCTCACCGCACTCGGCCGCCGCGGCGTCCTC
GTCGGCGACGGCCCCGGGTTCGTGACCAGCCGCGTACTGCACCGCATGATCAACGACGCG
GCCCGCATCGTGCAGGAGGGCCGCGCGAGCGCCGAGGACGTCGACACCCTGATGCAGGAC
TGCCTCGGGCACCGCACCGGGCCGCTGCGCACCGCCGACCTGATCGGCATCGACAACCTC
GTCGACTCCCTGCGGGTGCTGCACGAGCGCACCGGCGACGAAGGCTGCCGCCCGTGCGAG
CTGCTGCTCCAGAAGGTGCGCGACGGCGAGCACGGCCGCAAGAGCGGCCAGGGCTTCTAC
ACGTACACGGGAGTGGTCTCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR006108 3-hydroxyacyl-CoA dehydrogenase, C-terminal (Domain)
 [186-282]  2.2e-29 PF00725
PF00725   3HCDH
IPR006176 3-hydroxyacyl-CoA dehydrogenase, NAD binding (Domain)
 [10-183]  2.19999999999997e-43 PF02737
PF02737   3HCDH_N
IPR008927 6-phosphogluconate dehydrogenase, C-terminal-like (Domain)
 [185-284]  1.29999924468179e-28 SSF48179
SSF48179   6DGDH_C_like
IPR013328 Dehydrogenase, multihelical (Domain)
 [188-282]  7e-29 G3DSA:1.10.1040.10
G3DSA:1.10.1040.10   Opine_DH
IPR016040 NAD(P)-binding domain (Domain)
 [8-187]  6.90000000000001e-41 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR022694 3-hydroxyacyl-CoA dehydrogenase (Family)
 [2-286]  8.99992502689852e-70 PIRSF000105
PIRSF000105   HCDH
SignalP
 [1-28]  0.706 Signal
Bacteria, Gram-negative   
 [1-28]  0.43 Signal
Eukaryota   
 [1-38]  0.554 Signal
Bacteria, Gram-positive   
TMHMM
 [12-34]  Transmembrane (i-o)
Transmembrane 1