close all open/close all

CDS information : Oxzol_00150


close this sectionLocation

Organism
StrainJA3453
Entry nameOxazolomycin
Contig
Start / Stop / Direction43,715 / 52,495 / + [in whole cluster]
43,715 / 52,495 / + [in contig]
Location43715..52495 [in whole cluster]
43715..52495 [in contig]
TypeCDS
Length8,781 bp (2,926 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)PKS type I
Gene
Gene (GenBank)ozmJ
EC number
Keyword
  • serine
Note
Note (GenBank)
Reference
ACC
PmId
[20406823] Oxazolomycin biosynthesis in Streptomyces albus JA3453 featuring an "acyltransferase-less" type I polyketide synthase that incorporates two distinct extender units. (J Biol Chem. , 2010)

close this sectionPKS/NRPS Module

10
KS59..405
acp516..585
ACP777..847
ks913..1283
DH1516..1678
ER1995..2300
KR2310..2490
ACP2589..2662

close this sectionSequence

selected fasta
>polyketide synthase [PKS type I]
MSSANFRDILDGYVRGAVGAEQARGLLDAGRTDPDQGKEERPEPAADAADPIDRSRMLDI
AVVGMAGQFPGAADVRAFWRNLTEGRVGYGELPAHYTAPDDPAGYRWGGALTERDHFDAE
FFGIRPHEADLMSHNQRLLLQESWHALEDAAIDPTSLAGSRTGLFIGAEPTGYPHESFTG
ASDALVASRLSYFLDLRGAALVVNTACSSSLAAVHLACQSLSSGESTLALAGGVNAGLDA
RGLDLLVESGAMSPSGECRTFDADANGTVYSEAVAVLVLKRLSDAVADGDHVHGVIRATG
MNQDGASNGITAPNGAAQEELVLDVYRRFGIPAERVGYVEAHGTGTALGDPVEANALVRA
FRRLTGERGFAALGSAKAHIGHTGAPAGVVGMIKVLLSMRYGRLVGMPTLRDLNPLIDLT
GSAFVADATAGPWRHPAGVPLMAAVNSFGHSGTNAHVVVEQYVPVTGRERAEDGAPQVVP
LSARTPERLRAYAKALAEHLADAPAAAAPPAPRPVAPARVCAVVADVLGVDADEIDPDEP
LDSYGVRPEQLARIGEALDAGFGGRSGGEAPHEGSTAAELARLVDVSWNTADDARTGGAG
PSLGEVARTLQLGRAELASRAALVVRDMDGLVRGLRALAGGTELPDDCWVGEGDGRSDVA
RLFADDELREAVGKWLERGKLTRAAELWVRGGPVDWAVLHRNGTPTRIALPGYPFAAIRH
GIPMTAQASVPAPAPAPASAFAPAPAPEPALDPVTVAAPPVSVEPVEQRPERLAEAVERR
IALMATELLGGTEGAGEVDPREQLDRYGIDSVTRTRLNQLLSEAFPAASRTLFFEFAKVE
AVSAHLVERFPDACRTFLGRDAAPAEPAAAADTDTAGNTDTDGATDTDGATGTDGDPGTG
GDTDLGLDDFPDAVAVIGMSGVFPGAPDPDGLWELLMAGRSAVTEVPGRRWDWREHYDPH
PEGADVVGKSHSKWGAFLDGFDAFDPAVFGFTEQEARNTDPQVRLFLQECWKALEDAGIA
PSKLPSETRGRIGVFAGGAKHGFTQLGAEGRLEMPRTSFGDMVNRVSFQFDLGGPSKAVD
TACSSAHVALHEAVESIRSGRCDLALAGAVNLYLHPSTYVELATVGLLSDRDDCASFGAE
AAGIVPGEGVGAVLLKPLRQARRDGDPVHAVIRGSAVNHNGRTIGFTSPSSQRQAEVIRE
ALRDARVDPRTIGYVEATANGSEIGDAVEMTSLTQVFEDRPDARGPYRIGSLKPNIGHGE
ASAGMAQLFKVILALRHRTLPPTRLPGEYNPAIDIDRLPFELSGAPVAWDQVTVDGALVP
RRAGITGLGGGGTNAHVVLEEAPERTPRPRPTGRAPFLFVLSAHTRERLDAYADLWLDFL
GQRPVAAMADIAYTLQVGRTDLTHRLAVVASGAEELRGHLTRWRRGRPSDAVFSATAARV
DASGLDAALRERDLGRVADLWVRGAAVDWNALHGEDGSRPPRVPGLPTYPFERLSCWVEE
PVPAARAESSAPVAGHPLLTSRVELSDGGTVFSGEVSLGTHPWIADHAVSGTVLFPGTGF
VEMALHAGRALGCGRLDELTLEAPLTLTEQAPEGAQLQLVVGTPDTTGSRPVEVHSRPLA
AEGAWTRHAAGLLAADGTEAGFDLTAWPPAGAQSVPVDDYYQVMADAGYAYGPAFRGLRE
VWRRGDEVFAEAALDDADDAARYGVHPALLDSALHAMGFGGFVRDGGGLLPFSWTGMRLF
AGGAARVRVRLTGAGTDAVSAAVADATGRPLAVLESLVLRPVAGAAPKPARAALPDELLR
LEWTPLAPVDAADGAEGGWSVEGPDELGLAAALRDAGAEVTDEGPTALLSLHAGPAPDLA
AGIRAATARAHGLVRAWLNDERQTAARLVVVTRRAVSTRVGEDVHDLAHAPVWGLLRAAQ
AENPERLLLVDVDADGASAAALPAAVASAVAAGESQLALRAGEALVPRLAPLASDGALVP
PGGGTAWRLDTSGAGTLENLALLPWPAADAPLGPGQVRIEVRAAGLNFRDVLGALGMYPG
ELTLGAEGAGVVLDTGDGVTHLAVGDRVMGLFPSGLGPVCVADAHTVVAMPDGWSYEEAA
AVPVAFATAYYGLVDMGGLGSGESVLVHAAAGGVGMAAVQLARHLGAEVFATASEGKWDA
VRALGVPDDHLASSRDLGFEDRFRTVTGGRGVDVVLDSLAKEFVDASLRLLPRGGRFVEM
GKTDIRDAAQVAAEHFAVRYRAFDIVDAGPRRIGEILAEIVGLFERGVLAHLPRRAWDLR
RAPEAFRFMSRARHVGKIVLTVPRRPDPEDTVLITGGTGTLGGMLARHLVTERGARRLLL
LGRRGPDAPGAAELTAELVAAGAEVTVVACDVADRDALAQVLDAIPAEHPLGTVVHTAGD
LDDGVFDALTPERLARVLRPKAEGAWNLHELTRGTGLAEFVMFSGAAGVLGNPGQSNYAA
ASSFLDALAQHRRANGLPGTSLAWGYWEQATGLTKHLSEGDTGRMARGGLLPLPSAAGLA
LFDLARGADAPLQVPMRLDLDALRTQADAGEGHPLHRGLLRSAPRTAAATAGRTGRDLDG
LAALPSDEQLARLLELVCETVGSVLVTDPSTIGPDTGFVELGLDSLTAVELRNRLNRATG
LRLPVTLVFDHPAPGPLAAYLRRRLTAGGEGLTRGEAAPAAEPVAGAATPRPRDPVAAAP
SEPAETPAAAAPADTPHPLLAGADLETLGAVLDFGCRDAASLDRLAAEYPALIVHGATSD
KELAETGLRQPGDRVALFHRSGPLDPFPGQYDLAYGVDACYRVEDKQALFARLDAAVVDG
GRLLVADHVCTLSGDLVDPGAGISVPTARTWAEVFARNRFVVEETRTDDSAAGGPDPDLA
EPLRRGWIGRRLFHLRKQTSGTQEDRLRTNRAHLAGTTAQPRAPRS
selected fasta
>polyketide synthase [PKS type I]
ATGAGCAGCGCTAACTTCCGCGACATCCTCGACGGATACGTCAGGGGCGCGGTCGGCGCG
GAGCAGGCACGCGGTCTCCTCGACGCGGGCCGCACGGACCCGGACCAGGGCAAGGAAGAA
CGGCCGGAGCCCGCGGCCGACGCCGCGGACCCCATCGACCGCTCGCGGATGCTGGACATC
GCGGTCGTCGGCATGGCCGGGCAGTTCCCGGGAGCGGCGGACGTCCGCGCGTTCTGGCGC
AACCTCACCGAGGGCCGCGTCGGCTACGGCGAGCTGCCCGCCCATTACACCGCCCCGGAC
GATCCGGCGGGCTACCGCTGGGGCGGCGCCCTCACCGAACGCGACCACTTCGACGCGGAG
TTCTTCGGCATCCGGCCGCACGAGGCCGACCTGATGAGCCACAACCAGCGGCTCCTGCTC
CAGGAGAGCTGGCACGCCCTGGAGGATGCCGCGATCGACCCGACGTCGCTCGCCGGGTCC
CGTACCGGCCTGTTCATCGGCGCCGAGCCCACCGGCTACCCGCACGAGTCGTTCACCGGC
GCGTCCGACGCACTGGTGGCCTCCCGGCTCTCGTACTTCCTGGATCTGCGCGGCGCCGCC
CTCGTGGTGAACACGGCCTGCTCCTCCTCGCTGGCCGCCGTGCACCTGGCCTGCCAGAGC
CTGAGCTCGGGCGAGTCCACCCTGGCGCTGGCCGGGGGCGTGAACGCGGGCCTCGACGCG
CGCGGCCTCGACCTCCTGGTGGAGAGCGGCGCGATGTCGCCGAGCGGTGAGTGCCGCACC
TTCGACGCCGACGCCAACGGCACCGTCTACTCCGAGGCGGTGGCCGTCCTCGTACTGAAG
CGGCTCTCCGACGCGGTGGCCGACGGGGACCACGTGCACGGCGTCATCCGCGCCACCGGC
ATGAACCAGGACGGCGCGAGCAACGGCATCACCGCCCCGAACGGCGCTGCCCAGGAGGAA
CTGGTCCTCGACGTCTACCGCCGCTTCGGCATCCCCGCCGAGCGCGTCGGATACGTGGAG
GCCCACGGCACCGGCACGGCGCTCGGCGACCCGGTGGAGGCCAACGCGCTGGTACGGGCG
TTCCGGCGGCTCACCGGTGAGCGCGGGTTCGCCGCACTCGGCAGCGCCAAGGCGCACATC
GGCCACACGGGCGCCCCCGCCGGGGTCGTCGGCATGATCAAGGTGCTGCTCTCGATGCGG
TACGGCCGGCTCGTCGGCATGCCGACGCTGCGCGACCTCAACCCGCTGATCGACCTCACG
GGCTCGGCGTTCGTCGCCGACGCGACGGCGGGCCCGTGGCGACACCCCGCCGGGGTGCCG
TTGATGGCCGCGGTCAACTCCTTCGGCCACAGCGGGACCAACGCGCACGTCGTCGTCGAG
CAGTACGTGCCCGTCACCGGACGCGAGCGGGCCGAGGACGGGGCGCCCCAGGTCGTACCG
CTGTCGGCGCGCACGCCCGAACGGCTGCGCGCGTACGCGAAGGCCCTCGCGGAGCATCTG
GCGGACGCCCCTGCCGCCGCCGCTCCGCCCGCTCCGCGCCCGGTGGCGCCCGCGCGGGTG
TGCGCCGTGGTGGCCGACGTCCTCGGCGTCGACGCCGACGAGATCGACCCGGACGAGCCC
CTGGACTCCTACGGGGTGCGGCCGGAGCAGCTCGCCCGCATCGGCGAGGCCCTGGACGCC
GGGTTCGGCGGGCGCTCCGGCGGCGAGGCCCCGCACGAGGGCAGCACGGCGGCCGAACTG
GCGCGCCTGGTCGACGTGTCGTGGAACACCGCCGATGACGCCCGTACCGGAGGCGCCGGC
CCCTCGCTCGGCGAGGTGGCACGCACGTTGCAGCTCGGGCGCGCGGAACTCGCGTCGCGC
GCGGCGCTCGTCGTGCGGGACATGGACGGACTCGTCCGCGGCCTCCGCGCGCTGGCCGGG
GGCACCGAACTGCCCGACGACTGCTGGGTGGGCGAGGGGGACGGGCGTTCGGACGTCGCC
CGGCTCTTCGCCGACGACGAACTGCGGGAGGCCGTCGGCAAATGGCTGGAGCGCGGGAAG
CTGACGCGGGCGGCCGAGCTGTGGGTCCGGGGCGGCCCCGTGGACTGGGCCGTACTGCAC
AGGAACGGCACGCCGACGAGGATCGCCCTGCCCGGCTACCCCTTCGCCGCGATCCGTCAC
GGCATCCCCATGACCGCGCAGGCTTCCGTGCCTGCGCCTGCTCCTGCGCCTGCTTCTGCT
TTTGCTCCTGCTCCTGCTCCTGAGCCTGCTCTCGATCCCGTGACCGTCGCGGCGCCGCCG
GTCTCCGTCGAGCCGGTGGAACAGCGGCCCGAGCGCCTCGCGGAGGCGGTGGAGCGGCGG
ATCGCGCTCATGGCCACGGAGCTGCTCGGCGGCACGGAGGGCGCCGGTGAGGTCGACCCC
AGGGAGCAGTTGGACCGCTACGGCATCGACTCCGTCACCCGCACCCGGCTGAACCAACTC
CTGAGCGAGGCGTTCCCCGCGGCATCCCGGACCCTGTTCTTCGAGTTCGCCAAGGTCGAG
GCCGTGTCCGCGCACCTCGTCGAGCGCTTCCCCGACGCCTGCCGGACGTTCCTCGGCCGG
GACGCGGCACCCGCGGAGCCCGCGGCGGCGGCCGACACCGACACTGCTGGCAACACCGAC
ACTGACGGCGCCACCGACACTGACGGCGCCACCGGGACCGATGGCGACCCCGGGACCGGT
GGCGACACCGACCTCGGCCTCGACGACTTCCCCGATGCCGTCGCCGTGATCGGCATGAGC
GGTGTCTTCCCCGGCGCCCCCGACCCGGACGGTCTCTGGGAGCTGCTCATGGCGGGGCGC
AGCGCCGTCACCGAAGTGCCCGGCCGGCGGTGGGACTGGCGCGAGCACTACGACCCGCAC
CCCGAGGGGGCGGACGTGGTGGGCAAGAGCCACTCCAAGTGGGGTGCGTTCCTCGACGGG
TTCGACGCGTTCGACCCCGCGGTCTTCGGCTTCACCGAGCAGGAGGCCCGCAACACCGAC
CCGCAGGTGCGCCTCTTCCTCCAGGAGTGCTGGAAGGCCCTGGAGGACGCGGGCATCGCC
CCGTCGAAGCTGCCCTCGGAGACCCGTGGCCGGATCGGTGTCTTCGCGGGCGGCGCCAAG
CACGGCTTCACGCAGCTCGGCGCCGAGGGGCGCCTGGAGATGCCGCGCACCTCGTTCGGC
GACATGGTCAACCGGGTCTCGTTCCAGTTCGACCTCGGGGGCCCGAGCAAGGCCGTGGAC
ACCGCCTGCTCATCGGCCCACGTGGCCCTGCACGAGGCGGTCGAGAGCATCCGCTCGGGC
CGCTGCGACCTGGCCCTGGCCGGGGCGGTGAACCTCTATCTGCACCCCTCCACCTACGTC
GAACTGGCCACGGTCGGCCTGCTGTCCGACCGCGACGACTGCGCGTCCTTCGGCGCCGAG
GCCGCGGGGATCGTCCCCGGCGAGGGCGTCGGCGCGGTGCTGCTCAAGCCGCTGCGGCAG
GCCCGGCGCGACGGCGACCCGGTGCACGCGGTCATCCGCGGCAGCGCCGTCAACCACAAC
GGCCGCACCATCGGCTTCACGAGTCCCAGCTCCCAGCGGCAGGCCGAGGTGATCCGCGAG
GCTCTGCGCGACGCCCGCGTGGACCCGCGGACCATCGGCTACGTGGAGGCCACGGCGAAC
GGCTCCGAGATCGGCGACGCCGTCGAGATGACGTCGCTCACCCAGGTCTTCGAGGACCGT
CCGGACGCCCGCGGCCCGTACCGCATCGGCTCGCTGAAGCCCAACATCGGCCACGGCGAG
GCCTCCGCGGGCATGGCGCAGCTCTTCAAGGTCATCCTCGCGCTCCGGCACCGCACGCTG
CCGCCGACCCGGCTGCCCGGCGAGTACAACCCGGCCATCGACATCGACCGGCTCCCCTTC
GAGCTGTCCGGCGCCCCGGTGGCCTGGGACCAGGTCACGGTCGACGGCGCCCTCGTGCCG
CGCCGCGCCGGGATCACCGGCCTCGGCGGGGGCGGCACCAACGCGCACGTCGTCCTGGAG
GAGGCTCCCGAGCGGACGCCCCGCCCGCGACCCACCGGGCGCGCCCCCTTCCTCTTCGTC
CTCTCGGCGCACACGCGGGAACGCCTTGACGCCTACGCCGACCTCTGGCTCGACTTCCTC
GGGCAGCGGCCCGTCGCCGCCATGGCGGACATCGCGTACACCCTGCAAGTGGGCCGTACG
GACCTGACCCACCGCCTCGCGGTCGTCGCCTCGGGGGCCGAGGAGCTGCGCGGGCATCTG
ACGCGGTGGCGCCGGGGCCGCCCCTCCGACGCGGTCTTCTCGGCCACGGCCGCCCGGGTG
GACGCTTCGGGGCTCGACGCCGCGCTGCGCGAGCGGGACCTCGGCCGGGTGGCGGACCTG
TGGGTGCGCGGCGCGGCCGTCGACTGGAACGCTCTCCACGGGGAGGACGGCAGCCGGCCC
CCGCGGGTGCCCGGCCTGCCCACGTATCCCTTCGAGCGCCTGAGCTGCTGGGTCGAGGAG
CCCGTCCCGGCGGCGCGCGCGGAGTCTTCCGCACCCGTCGCGGGGCACCCGCTCCTCACG
TCCCGCGTCGAACTCAGCGACGGCGGCACCGTGTTCAGCGGCGAGGTGTCGCTCGGCACG
CACCCCTGGATCGCGGACCACGCGGTGTCCGGCACGGTCCTCTTCCCCGGCACCGGCTTC
GTCGAGATGGCGCTGCACGCCGGGCGGGCCCTCGGCTGCGGGCGCCTCGACGAACTCACC
CTCGAAGCTCCGCTCACCCTGACGGAACAGGCGCCGGAAGGCGCACAACTCCAGCTCGTC
GTGGGAACGCCCGACACCACGGGCAGCCGCCCCGTGGAGGTGCACTCACGCCCACTCGCC
GCCGAGGGAGCATGGACGCGGCACGCCGCCGGGCTGCTCGCGGCGGACGGGACGGAGGCC
GGTTTCGATCTGACGGCGTGGCCGCCGGCCGGCGCGCAGTCCGTACCGGTGGACGACTAC
TACCAGGTGATGGCCGACGCCGGGTACGCCTACGGCCCCGCGTTCCGCGGGCTGCGCGAG
GTCTGGCGGCGCGGCGACGAGGTCTTCGCCGAAGCCGCGCTCGACGACGCCGACGACGCG
GCCCGCTACGGGGTGCACCCCGCGCTGCTCGACTCCGCCCTGCACGCGATGGGCTTCGGC
GGCTTCGTGCGGGACGGCGGCGGTCTGCTGCCGTTCTCCTGGACCGGGATGCGGCTGTTC
GCGGGCGGGGCGGCCAGGGTGCGGGTGCGGCTCACCGGCGCCGGCACCGACGCGGTCTCG
GCCGCGGTCGCGGACGCCACCGGCAGGCCGCTGGCCGTACTCGAATCGCTGGTGCTGCGG
CCGGTCGCGGGCGCCGCCCCGAAGCCGGCGCGCGCCGCCCTGCCCGATGAACTGCTGCGC
CTGGAGTGGACGCCGCTCGCCCCGGTCGATGCCGCCGATGGGGCCGAGGGCGGGTGGAGC
GTCGAGGGCCCCGACGAACTGGGTCTCGCCGCCGCCCTGCGGGACGCGGGCGCCGAGGTG
ACGGACGAGGGCCCGACCGCGCTGCTCTCCCTGCACGCCGGTCCCGCGCCCGACCTCGCG
GCCGGGATCAGGGCCGCCACCGCGCGCGCCCACGGCCTGGTGCGGGCCTGGCTGAACGAC
GAGCGGCAGACCGCGGCACGCCTCGTGGTCGTGACCCGGCGGGCCGTCTCCACCCGCGTC
GGCGAGGATGTCCACGACTTGGCGCACGCCCCGGTGTGGGGTCTGCTGAGGGCCGCCCAG
GCGGAGAACCCCGAGCGGCTCCTCCTGGTCGACGTGGACGCCGACGGGGCCTCGGCCGCC
GCACTGCCCGCGGCCGTCGCCTCCGCGGTGGCCGCCGGTGAGTCGCAGCTCGCCCTGCGC
GCGGGAGAGGCCCTCGTGCCCCGCCTCGCCCCGCTCGCATCGGACGGCGCGCTCGTGCCG
CCCGGCGGCGGCACCGCGTGGCGCCTGGACACCAGCGGCGCGGGCACGCTGGAGAACCTC
GCCCTGCTGCCGTGGCCCGCGGCCGACGCGCCGCTCGGCCCCGGACAGGTACGGATCGAG
GTGCGCGCCGCGGGCCTCAACTTCCGTGACGTCCTCGGCGCGCTCGGCATGTACCCCGGC
GAGCTGACGCTCGGCGCCGAAGGGGCCGGCGTGGTGCTCGACACCGGCGACGGCGTCACC
CACCTCGCCGTCGGCGACCGCGTGATGGGCCTCTTCCCCAGCGGCCTCGGACCGGTCTGC
GTGGCCGACGCGCACACGGTCGTGGCGATGCCCGACGGCTGGTCCTACGAGGAGGCGGCG
GCCGTCCCCGTGGCGTTCGCCACCGCCTACTACGGCCTGGTCGACATGGGCGGCCTCGGC
TCGGGCGAGTCGGTCCTCGTGCACGCCGCCGCGGGCGGCGTGGGCATGGCCGCCGTACAG
CTCGCCCGGCACCTCGGTGCGGAGGTCTTCGCCACCGCGAGCGAGGGCAAGTGGGACGCC
GTGCGCGCCCTCGGCGTGCCCGACGACCACCTGGCCTCCTCGCGCGACCTGGGCTTCGAG
GACCGCTTCCGCACCGTCACCGGCGGACGGGGTGTGGACGTCGTACTGGACTCGCTCGCC
AAGGAGTTCGTCGACGCCTCGCTGCGGCTGCTGCCGCGCGGCGGCCGGTTCGTGGAGATG
GGCAAGACCGACATCCGTGACGCGGCGCAGGTGGCGGCCGAGCACTTCGCCGTGCGCTAC
CGGGCGTTCGACATCGTCGACGCGGGACCGCGCCGTATCGGGGAGATCCTCGCCGAGATC
GTCGGCCTCTTCGAGCGCGGCGTCCTGGCCCACCTGCCCCGGCGCGCCTGGGACCTGCGG
CGGGCGCCCGAGGCCTTCCGGTTCATGAGCCGGGCCAGGCACGTCGGCAAGATCGTGCTC
ACGGTGCCGCGCCGGCCGGACCCCGAGGACACCGTCCTGATCACCGGCGGCACCGGCACC
CTGGGCGGCATGCTCGCCCGGCACCTGGTGACCGAGCGCGGGGCCCGGCGTCTGCTGCTG
CTCGGCAGGCGCGGCCCGGACGCGCCGGGGGCGGCGGAGCTGACCGCCGAACTCGTCGCC
GCGGGTGCGGAGGTGACCGTCGTGGCCTGCGATGTCGCCGACCGGGACGCCCTCGCGCAG
GTGCTCGACGCGATCCCCGCCGAGCATCCGCTCGGCACCGTCGTGCACACCGCGGGCGAC
CTCGACGACGGCGTCTTCGACGCGCTGACCCCCGAGCGGCTCGCGCGGGTCCTGCGGCCC
AAGGCGGAGGGCGCCTGGAACCTCCACGAGCTGACCCGGGGGACCGGCCTCGCCGAGTTC
GTGATGTTCTCCGGCGCGGCGGGCGTGCTCGGCAACCCCGGGCAGTCCAACTACGCGGCG
GCCAGCTCCTTCCTCGACGCGCTCGCCCAGCACCGCAGGGCGAACGGACTGCCGGGCACC
TCACTGGCCTGGGGGTACTGGGAGCAGGCCACGGGCCTCACGAAGCACCTGAGCGAGGGC
GACACGGGCAGGATGGCCCGCGGCGGCCTGCTGCCCCTGCCCTCCGCGGCCGGTCTCGCC
CTCTTCGACCTGGCCCGGGGCGCGGACGCACCGCTCCAGGTCCCGATGCGCCTCGACCTC
GACGCGCTGCGCACGCAGGCGGACGCGGGGGAGGGCCACCCGCTCCACCGCGGCCTGCTG
CGGAGCGCGCCGCGGACGGCCGCGGCCACCGCCGGGCGGACCGGCAGGGACCTCGACGGG
CTCGCCGCCCTGCCCTCGGACGAGCAGCTCGCCCGGCTCCTTGAGCTGGTGTGCGAGACG
GTGGGCTCGGTCCTGGTGACCGACCCGTCCACCATCGGCCCGGACACCGGCTTCGTCGAA
CTGGGCCTCGACTCCCTGACCGCGGTGGAGCTCCGCAACCGCCTCAACCGGGCGACGGGC
CTGCGCCTGCCGGTGACCCTGGTCTTCGACCACCCGGCGCCCGGGCCGCTGGCCGCGTAT
CTGCGGCGGCGCCTCACCGCGGGCGGCGAGGGGCTCACACGGGGGGAGGCGGCCCCTGCC
GCCGAACCGGTGGCCGGGGCCGCCACGCCGAGGCCCCGGGACCCGGTGGCCGCCGCCCCC
TCGGAACCGGCGGAGACTCCCGCCGCCGCGGCGCCCGCGGACACCCCGCACCCCCTTCTC
GCCGGCGCGGACCTGGAGACCCTCGGTGCCGTCCTCGACTTCGGCTGCCGCGACGCCGCG
TCGCTCGACCGCCTGGCCGCCGAGTACCCCGCGCTCATCGTGCACGGGGCGACCTCCGAC
AAGGAGCTGGCCGAGACCGGGCTACGGCAGCCGGGAGACCGCGTCGCGCTGTTCCACCGG
AGCGGGCCGCTCGATCCCTTCCCGGGCCAGTACGACCTGGCGTACGGCGTCGACGCCTGT
TACCGCGTGGAGGACAAGCAGGCCCTCTTCGCCCGGCTCGACGCGGCCGTCGTGGACGGC
GGGCGGCTCCTCGTCGCCGATCACGTCTGCACGCTCAGCGGCGACCTCGTCGACCCCGGC
GCCGGAATCAGCGTCCCCACCGCCCGCACCTGGGCCGAGGTCTTCGCACGGAACCGCTTC
GTGGTTGAGGAGACGCGCACCGACGACTCCGCCGCCGGGGGCCCCGACCCCGACCTGGCC
GAGCCGCTGCGGCGGGGCTGGATCGGACGCCGCCTGTTCCACCTGCGCAAGCAGACCTCC
GGCACCCAGGAGGACCGCCTGCGGACCAACCGGGCCCACCTGGCCGGGACCACCGCGCAG
CCGCGCGCCCCGCGGAGCTGA
[10] KS59..405
[10] acp516..585
[10] ACP777..847
[10] ks913..1283
[10] DH1516..1678
[10] ER1995..2300
[10] KR2310..2490
[10] ACP2589..2662
[10] KS175..1215
[10] acp1546..1755
[10] ACP2329..2541
[10] ks2737..3849
[10] DH4546..5034
[10] ER5983..6900
[10] KR6928..7470
[10] ACP7765..7986

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002364 Quinone oxidoreductase/zeta-crystallin, conserved site (Conserved_site)
 [2122-2143]  PS01162
PS01162   QOR_ZETA_CRYSTAL
IPR006162 Phosphopantetheine attachment site (PTM)
 [2620-2635]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [516-585]  PS50075 [777-847]  PS50075 [2589-2662]  PS50075
PS50075   ACP_DOMAIN
 [508-602]  3.00000067992871e-07 SSF47336 [770-928]  3.30000164480624e-08 SSF47336 [2585-2679]  5.39999384454126e-23 SSF47336
SSF47336   ACP_like
 [2593-2661]  1.2e-13 PF00550
PF00550   PP-binding
 [518-585]  1.5e-36 G3DSA:1.10.1200.10 [775-851]  1.5e-36 G3DSA:1.10.1200.10 [2593-2665]  1.5e-36 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
IPR011032 GroES-like (Domain)
 [1986-2129]  1.20000117458134e-31 SSF50129
SSF50129   GroES_like
IPR013149 Alcohol dehydrogenase, C-terminal (Domain)
 [2133-2231]  1.6e-20 PF00107
PF00107   ADH_zinc_N
IPR013154 Alcohol dehydrogenase GroES-like (Domain)
 [2014-2086]  1.8e-08 PF08240
PF08240   ADH_N
IPR013968 Polyketide synthase, KR (Domain)
 [2311-2489]  1.6e-63 PF08659
PF08659   KR
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [59-285]  5.90000000000008e-65 PF00109 [913-1161]  2.79999999999994e-74 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [294-405]  3.5e-32 PF02801 [1169-1283]  3.29999999999997e-35 PF02801
PF02801   Ketoacyl-synt_C
IPR016038 Thiolase-like, subgroup (Domain)
 [60-297]  G3DSA:3.40.47.10 [299-462]  3.70000000000004e-98 G3DSA:3.40.47.10 [914-1173]  G3DSA:3.40.47.10 [1174-1345]  3.70000000000004e-98 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [50-407]  6.69996745106047e-75 SSF53901 [911-1344]  2.89997807423187e-79 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [2085-2270]  4.30000000000003e-54 G3DSA:3.40.50.720 [2310-2496]  1.2e-34 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [1074-1090]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [777-850]  9.69999663390112e-05 SM00823 [2594-2665]  5.29999657550189e-29 SM00823
SM00823   PKS_PP
IPR020807 Polyketide synthase, dehydratase domain (Domain)
 [1516-1678]  4.30000170645869e-80 SM00826
SM00826   PKS_DH
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [60-464]  SM00825 [914-1344]  SM00825
SM00825   PKS_KS
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [2310-2490]  1.99999636034521e-61 SM00822
SM00822   PKS_KR
IPR020843 Polyketide synthase, enoylreductase (Domain)
 [1995-2300]  SM00829
SM00829   PKS_ER
SignalP
 [1-6]  0.101 Signal
Bacteria, Gram-negative   
TMHMM No significant hit