close all open/close all

CDS information : Oxzol_00160


close this sectionLocation

Organism
StrainJA3453
Entry nameOxazolomycin
Contig
Start / Stop / Direction52,512 / 56,120 / + [in whole cluster]
52,512 / 56,120 / + [in contig]
Location52512..56120 [in whole cluster]
52512..56120 [in contig]
TypeCDS
Length3,609 bp (1,202 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)PKS
Gene
Gene (GenBank)ozmK
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[20406823] Oxazolomycin biosynthesis in Streptomyces albus JA3453 featuring an "acyltransferase-less" type I polyketide synthase that incorporates two distinct extender units. (J Biol Chem. , 2010)

close this sectionPKS/NRPS Module

11
acp5..73
KS83..444
MT884..987
ACP1115..1182

close this sectionSequence

selected fasta
>polyketide synthase [PKS]
MSPHVKQALSELAARVLDATPERVSAAPFEDLGLDLARAVELTEEINSRFGTTLSTGAVT
GAADLDGLARHVSEHLEGGAPPEAVAVIGMHCRTAGARDPEEFWQVIASGEDRTTEVDDP
VALSLLKEHFPDVAAPRCGRMADSDRFDPAFFRIAPREAAAMDAAQRVLLESCYHALEDA
AQDASALRGRAVATIVGSTGLAPQAEYSAHALMGADTSIMAARLAYQLDLSGPAMTVDTA
CSSSLVAVDIARRLLLDGESDLALAAGVYVANHPGTFVTMEALGTVSPGRACRPFDADAD
GMLVGEGVGVLVLKRLSDAVRDNDRVLGVIRGSATNQDGRTSGITSPSSAAQSALLRDVY
RRSGVDMGRLRYVEAHGTGTSLGDPIEVHGLTEAFAEFTDRRRFCAVGSVKANIGHTMGA
AGVLGAIKVLLCLRHGQLPPAANFRTENKHADFDESPVYVSREPADWNREGEEPRVAGVS
SFGYSGTNAHVIIEEYLDTRPAALPAPGRRMVLPLSAKSGEQLREKAAALAAHLRAAGPD
GFALHDVAYTLQVGREAFAERLAVTATTTEELLGRLDAFADGAAAVPGTYSGRAAERGTV
TRPTGRDVDEFAAAWVTGAAVDWPRLHTGTAPRRVALPGHPFAREVFPHAWADGTAPGTA
GRGGARGGEAAHPANAVPSVLADLDAAADEHLRSDPAAGNLGAALRSDVMVRELTAVCRR
MLLASLRRMDVFTTPGERCTEADLVSRLGVVDEHRALFRGLLGILTEGGFLRAEGTDLVT
TDQVAAAPLTWDEDELAALRSEVTDEYAEMDGYFHLLTLCLEEMPDVLTGRKKAHEVLFP
GGSFDAVEAVYHSDGDTNGLVARLVARYVRARRERAPGAALSVLEIGAGTGGTTAKVLPA
LDGGDGRLSYVYTDISRGFTQYGRNQYGKDHPYVTFAPLDIESAPVEQGFEAGSQDLVLA
CNVLHATRSIDDTLAHARQLLRPGGVLILLETTRAQDFFTLTFGLMGGWWAYEDDCRIPG
SPLLSVSLWRQALERGGFRAVRSLSPAPVREDQAYQAVVLAEKEGALDHTGPVVEPPDAP
VTPQVPVVVPTAGAAGAAGDAGDDESAGQAAGGPLQELVADAWREVLGVTSVRPEDDFQE
VGGDSILATQIISRLRSGFPFELELGELFQARTLADMVELLEAELIERIDELPEETVSTL
LA
selected fasta
>polyketide synthase [PKS]
ATGTCGCCCCACGTCAAGCAGGCGCTGTCGGAACTCGCGGCCCGTGTCCTCGATGCCACC
CCCGAGCGGGTCTCCGCCGCGCCCTTCGAGGACCTCGGCCTCGACCTCGCCAGGGCCGTG
GAGCTCACCGAGGAGATCAACTCCCGGTTCGGCACCACCCTCTCGACCGGTGCCGTCACC
GGGGCCGCCGATCTGGACGGGCTCGCCCGGCACGTGTCGGAGCACCTCGAAGGCGGCGCC
CCGCCGGAGGCCGTCGCGGTGATCGGCATGCACTGCCGCACCGCGGGCGCGCGCGACCCC
GAGGAGTTCTGGCAGGTGATCGCCTCGGGCGAGGACCGCACCACCGAGGTCGACGACCCG
GTGGCCCTCTCTTTGCTCAAGGAGCACTTTCCCGACGTGGCCGCGCCGCGCTGCGGGCGG
ATGGCGGACAGCGACCGCTTCGACCCGGCCTTCTTCCGCATCGCCCCGCGCGAGGCCGCC
GCGATGGACGCCGCCCAGCGCGTCCTGCTCGAATCCTGCTACCACGCCCTGGAGGACGCC
GCCCAGGACGCCTCCGCGCTCCGCGGGCGCGCCGTCGCCACCATCGTCGGCAGCACCGGC
CTCGCCCCTCAGGCCGAGTACTCCGCGCACGCCCTGATGGGCGCCGACACCAGCATCATG
GCGGCCCGCCTCGCCTACCAGCTCGACCTCAGCGGCCCGGCGATGACGGTCGACACCGCC
TGCTCGTCCTCCCTGGTCGCCGTCGACATCGCCCGCAGGCTGCTCCTGGACGGCGAGAGC
GACCTCGCGCTCGCCGCCGGGGTGTACGTGGCCAACCACCCCGGCACCTTCGTCACCATG
GAGGCCCTCGGTACCGTATCGCCGGGCCGGGCCTGCCGCCCCTTCGACGCCGACGCGGAC
GGCATGCTCGTCGGTGAGGGCGTCGGCGTACTCGTGCTGAAGCGCCTCTCCGACGCGGTG
CGCGACAACGACCGTGTCCTCGGCGTCATCCGCGGCAGCGCCACCAACCAGGACGGCCGC
ACCTCCGGCATCACCTCACCGAGCTCCGCCGCCCAGAGCGCGCTGCTGCGCGACGTCTAC
CGCCGCAGCGGCGTCGACATGGGCCGCCTGCGCTACGTGGAGGCGCACGGCACCGGCACC
AGCCTCGGCGACCCGATCGAGGTGCACGGCCTCACCGAGGCCTTCGCGGAGTTCACCGAC
CGCCGGCGGTTCTGCGCCGTCGGCTCGGTGAAGGCCAACATCGGCCACACCATGGGCGCC
GCGGGCGTCCTCGGCGCCATCAAGGTGCTGCTGTGCCTGCGGCACGGCCAGCTCCCACCG
GCCGCGAACTTCCGTACCGAGAACAAACACGCCGACTTCGACGAGAGCCCTGTCTACGTC
AGCCGCGAACCGGCCGACTGGAACCGCGAGGGCGAGGAGCCCCGCGTCGCGGGTGTCAGC
TCCTTTGGGTACAGCGGCACCAACGCCCACGTCATCATCGAAGAGTACCTCGACACCCGC
CCCGCGGCCCTGCCCGCCCCCGGACGCCGGATGGTCTTACCGCTCTCCGCCAAGAGCGGG
GAGCAGCTCCGCGAGAAGGCGGCGGCCCTCGCCGCCCACCTGCGTGCGGCCGGGCCGGAC
GGCTTCGCGCTCCACGACGTGGCGTACACCTTGCAGGTGGGCCGCGAGGCGTTCGCCGAG
CGCCTCGCCGTCACCGCCACGACGACGGAGGAACTGCTCGGCCGCCTCGACGCGTTCGCG
GACGGTGCCGCCGCCGTGCCGGGCACCTACAGCGGACGGGCCGCCGAGCGCGGCACCGTC
ACCCGTCCCACGGGGCGCGATGTCGACGAGTTCGCGGCGGCCTGGGTCACCGGAGCCGCG
GTGGACTGGCCACGCCTGCACACCGGGACCGCGCCGCGCCGCGTCGCCCTGCCGGGGCAT
CCCTTCGCGCGCGAGGTCTTCCCGCACGCCTGGGCGGACGGCACCGCGCCCGGCACGGCG
GGCCGGGGCGGCGCCCGGGGCGGGGAGGCGGCCCACCCGGCGAACGCCGTGCCCTCCGTC
CTCGCCGACCTCGACGCCGCCGCCGACGAGCACCTGCGGTCCGACCCGGCCGCCGGAAAC
CTCGGGGCGGCGCTGCGCTCGGACGTGATGGTGCGCGAGCTGACCGCGGTGTGCCGCCGG
ATGCTCCTCGCCTCGCTGCGCCGCATGGACGTCTTCACGACGCCGGGTGAGCGGTGCACC
GAGGCGGACCTGGTGAGCCGGCTCGGCGTCGTGGACGAGCACAGGGCACTCTTCCGCGGG
CTGCTCGGCATCCTCACCGAGGGCGGCTTCCTGCGCGCCGAGGGCACGGACCTGGTCACC
ACCGACCAGGTCGCCGCCGCCCCGCTGACCTGGGACGAGGACGAACTGGCCGCGCTCAGG
AGCGAGGTGACCGACGAGTACGCCGAGATGGACGGGTACTTCCACCTCCTGACGCTCTGC
CTGGAGGAGATGCCCGACGTCCTCACCGGCCGCAAGAAGGCGCACGAAGTGCTCTTCCCC
GGCGGCTCGTTCGACGCCGTGGAGGCCGTCTACCACAGCGACGGCGACACCAACGGCCTG
GTGGCCCGACTCGTCGCCCGCTACGTCCGCGCCCGGCGCGAGCGCGCTCCCGGGGCCGCG
CTCTCCGTCCTGGAGATCGGCGCGGGCACCGGCGGCACCACCGCCAAGGTGCTGCCCGCG
CTCGACGGCGGCGACGGACGGCTCAGCTACGTCTACACCGACATCTCGCGCGGCTTCACC
CAGTACGGACGCAACCAGTACGGCAAGGACCACCCCTACGTCACCTTCGCGCCGCTGGAC
ATCGAGTCGGCGCCCGTGGAGCAGGGCTTCGAGGCGGGCAGCCAGGACCTCGTCCTCGCC
TGCAACGTGCTCCACGCCACCCGCAGCATCGACGACACCCTCGCCCACGCCCGGCAGCTC
CTGCGCCCAGGAGGCGTCCTGATCCTCCTGGAGACCACGCGGGCGCAGGACTTCTTCACC
CTCACCTTCGGCCTGATGGGCGGCTGGTGGGCCTACGAGGACGACTGCCGCATCCCCGGC
TCCCCGCTGCTCAGCGTCTCCCTGTGGCGCCAGGCCCTGGAGCGCGGCGGCTTCCGCGCG
GTGCGCAGCCTCTCGCCGGCGCCCGTGCGCGAGGACCAGGCGTACCAGGCGGTCGTCCTC
GCCGAGAAGGAGGGCGCCCTCGACCACACGGGGCCCGTCGTGGAGCCGCCGGACGCCCCG
GTCACCCCGCAGGTCCCCGTCGTGGTGCCGACCGCCGGGGCCGCCGGGGCCGCCGGGGAC
GCCGGGGACGACGAGAGCGCCGGGCAGGCTGCCGGCGGTCCGCTCCAGGAGCTGGTGGCC
GATGCCTGGCGCGAGGTGCTCGGTGTCACCTCGGTCCGCCCGGAGGACGACTTCCAGGAG
GTGGGCGGCGACTCGATCCTGGCGACCCAGATCATCTCCCGGCTCAGGAGCGGCTTCCCC
TTCGAGCTCGAACTCGGCGAGCTGTTCCAGGCCCGGACCCTCGCGGACATGGTCGAGCTG
CTGGAGGCCGAACTGATCGAGCGCATCGACGAGCTGCCCGAGGAGACCGTCAGCACCCTG
CTCGCGTGA
[11] acp5..73
[11] KS83..444
[11] MT884..987
[11] ACP1115..1182
[11] acp13..219
[11] KS247..1332
[11] MT2650..2961
[11] ACP3343..3546

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR006162 Phosphopantetheine attachment site (PTM)
 [1140-1155]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [8-72]  1.1e-05 PF00550 [1118-1181]  1.1e-12 PF00550
PF00550   PP-binding
 [4-89]  1.99999999999999e-23 G3DSA:1.10.1200.10 [1107-1184]  4.5e-28 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [5-73]  PS50075 [1115-1182]  PS50075
PS50075   ACP_DOMAIN
 [3-99]  2.79999889404114e-10 SSF47336 [1108-1183]  2.00000075217457e-16 SSF47336
SSF47336   ACP_like
IPR013217 Methyltransferase type 12 (Domain)
 [884-987]  3e-15 PF08242
PF08242   Methyltransf_12
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [83-319]  7.90000000000016e-65 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [327-444]  1e-38 PF02801
PF02801   Ketoacyl-synt_C
IPR016038 Thiolase-like, subgroup (Domain)
 [90-330]  2.20000000000002e-71 G3DSA:3.40.47.10 [331-496]  3.5e-60 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [82-441]  8.39998014024973e-81 SSF53901
SSF53901   Thiolase-like
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [232-248]  PS00606
PS00606   B_KETOACYL_SYNTHASE
SignalP
 [1-26]  0.181 Signal
Eukaryota   
 [1-26]  0.115 Signal
Bacteria, Gram-negative   
 [1-26]  0.254 Signal
Bacteria, Gram-positive   
TMHMM No significant hit