close all open/close all

CDS information : Oxzol_00170


close this sectionLocation

Organism
StrainJA3453
Entry nameOxazolomycin
Contig
Start / Stop / Direction56,198 / 62,179 / + [in whole cluster]
56,198 / 62,179 / + [in contig]
Location56198..62179 [in whole cluster]
56198..62179 [in contig]
TypeCDS
Length5,982 bp (1,993 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.2 NRPS
Productnon-ribosomal peptide synthetase
Product (GenBank)NRPS
Gene
Gene (GenBank)ozmL
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[20406823] Oxazolomycin biosynthesis in Streptomyces albus JA3453 featuring an "acyltransferase-less" type I polyketide synthase that incorporates two distinct extender units. (J Biol Chem. , 2010)

close this sectionPKS/NRPS Module

12 serine
C46..399
A528..930
MT1029..1128
PCP1426..1492
C1526..1833

close this sectionSequence

selected fasta
>non-ribosomal peptide synthetase [NRPS]
MSREDLATSRKARLSPQKRALLEKLSGAARTSGTTRIPRRPADARPPLSFAQRRLWFLDQ
MVPGSPAYNVPMSFRVRGPLRREVLERAVEEVVRRHESLRTRLPSENGEPWQEIVDDVRV
PVELVDVSDDPARLDALVFEAGRRPFDLATGPLLRVTLYRLAPDLHVVLLNAHHVVVDGW
SLGLFWQELFTLYEAFAAGRPSPLPELAVQYADFAVWQREHLSGDRLENQLGYWRRQLGE
GTENLELPLDRPRPPVQTFEGGDLRDVYPAALRDALQALCRREGVSLFVVLLGALNVLLH
RCTGQSGIPVGSPVTNRTHVDIEPLIGMFVNTLVYRTDLAGDPDFREVLRRVQEVVNGAQ
QHQEVPFEVLVDALRPERYLSQNPLFQVCFNFLPARELKPGDELVIEAIEGVRIDTAKFD
LWISVVDCADELLVEVEYNRDVFDPGTVRRLMDAFRVVLEAAAAGPETPVSRLPVLPEAD
RRRIVEEWNDTARAFDGAERCLHDLIAGQAARTPDAPAVVFGGEELGYAELDRRANRLAH
WLRARGAGPESTVAVCAERSVDLVVALLGVLKSGAAYVPIDPDHPVRRRAFMLADAAPRI
VLTQEHLRDALPPTEAEVLALDTRAAELAEQPEGPVAHGAGPDTLAYMIYTSGSTGEPKG
VLNTHRGIVNRLLWMQDRYGLDATDRVLQKTPFSFDVSVWEFFWPLLTGATLVVAGPDEH
KDPARLAELIDGERVTTAHFVPSMLQVFLGQDGLAGRCADLRRVVCSGEALPFALQERFF
AKLPGTELHNLYGPTEAAVDVTSWQCVPGDERGVVPIGRPIANTRVLVLDERLNPVPVGV
VGEIHIGGVQVARGYHNRPELTEERFVPDPFGAPGERLYKTGDLARLLPDGAIEYRGRAD
FQVKVRGIRIEPGEVEATLTRHPGVLDAAVVTRDDPRAAGHKQLVAYVVPDTAPAATAPG
EDPMTERVAQWAEVFDQAYAQGTDPREADFNIVTWNSSYTGEPLPAEEMREWVDGTVERI
LALKPRRVLEIGCGTGLLLSRVAPHCESYHGTDISSAALDFVRTRLLADRPELANVTLSH
RAADRTAGIGDEPYDLVILNSVAQYFPDGAHLRTVLGQAVDSLAGNGAVFVGDLRNLALL
DTFHTDVELSRATAKLSVGRLRGRIARRTRQEQELLVHPAFFAALREENTAVSGVDVQLR
RGRHDNELTRYRYDAVLHVTPSAPGPQTDVVTIDWADCGGLAGVRRRLADERPGALAVLG
VPNARLGAVNAKRDRLRERDAEEIVGELVRDTGTDPAHVDPEQWWRLGAETGLTVTVTWM
PDATDGSYAVLLSRTGTHRVDLPASPADGPPQLTNDPAFDRAGTDLVRDLRRHLKDSVPD
YMVPSAFLPLRALPVGVNGKLDRDALPPVPDHADTDGAAAEPTTPTEHLLAELWAEVLGV
DDVGVHTNFFELGGDSIHTIHVVAKARQRGLEFAPQLVFRHGTVAALAAALDERAATDTA
APVRPAAGQDADTALSELSAAPGVVDVYPLSPFQQWALGEWREHPEPGLFLVHRMQLLKV
SGFSEDVFVDCFRQLISEHPLLRTTFAWEGLTEPVQVVHEEATPETAFADWRGLAGPEQD
TRLETYLSADRERGVDLGTASGLRYLVALLDADTALVVVSLNYFCLDGWSFEIVTDRLQE
LLDAAATGRAPSPAPERLPFKEFVEGVRALPARPAEEYWRRALAGLTRPTPLSEGVRAKL
PAQPAEDGCARQIITLDRDTTLGLRRLSQRAHLPLNALFQGAWALVNAAYTGTDDVVHGV
LLAGRSSPVADPEALSTTVGPAFNILPLRTRVDRERDTGAFLKELFGALVEMGGHETTPL
DTVLGWSDLPPGTLPCESYIVFQNVGVDTMERSGTAFFVSKMGFPLRLDVFPTNVVTVHL
SYHRDQVTDAAATRLLLGLRSVLEATLDGLDRPVGDLAAAALEERETPSGLGIFHEGEFR
VADIREQQGGERA
selected fasta
>non-ribosomal peptide synthetase [NRPS]
ATGTCCCGCGAAGATCTCGCCACCTCGCGCAAGGCGCGGCTGTCCCCGCAGAAGCGGGCC
CTGCTGGAGAAGCTGAGCGGCGCCGCCCGCACGTCGGGGACCACCCGCATCCCGCGCCGC
CCCGCCGACGCCCGCCCGCCGCTCTCCTTCGCCCAGCGCCGCCTGTGGTTCCTCGACCAG
ATGGTGCCCGGAAGTCCCGCGTACAACGTCCCGATGAGCTTCCGCGTCCGCGGGCCGCTG
CGCCGCGAGGTCCTGGAGCGGGCCGTCGAGGAGGTGGTGCGCAGGCACGAGTCGCTGCGC
ACCCGGCTGCCCAGCGAGAACGGTGAGCCGTGGCAGGAGATCGTGGACGACGTCCGCGTC
CCGGTCGAACTCGTCGACGTCAGCGACGACCCCGCGCGGCTCGACGCACTGGTCTTCGAG
GCGGGACGCCGCCCCTTCGACCTGGCCACGGGCCCGCTCCTGCGCGTCACCCTCTACCGG
CTCGCCCCCGATCTGCACGTGGTGCTGCTCAACGCCCACCACGTGGTCGTCGACGGCTGG
TCGCTCGGCCTGTTCTGGCAGGAACTCTTCACGCTGTACGAGGCGTTCGCCGCGGGCCGG
CCCTCACCGCTGCCCGAACTGGCCGTGCAGTACGCGGACTTCGCCGTCTGGCAGCGCGAG
CACCTCTCCGGCGACCGGCTGGAGAACCAGCTCGGCTACTGGCGGCGGCAACTGGGGGAG
GGCACGGAGAACCTGGAGCTTCCCCTCGACCGGCCCCGGCCGCCCGTCCAGACCTTCGAG
GGCGGCGACCTCAGGGACGTCTACCCCGCGGCCCTGCGCGACGCGCTCCAGGCGCTCTGC
CGCCGCGAGGGCGTCAGCCTGTTCGTCGTGCTGCTCGGCGCGCTGAACGTGCTCCTGCAC
CGCTGCACGGGCCAGAGCGGCATCCCCGTCGGCTCACCGGTGACCAACCGCACCCACGTC
GACATCGAGCCGCTGATCGGCATGTTCGTGAACACCCTCGTCTACCGGACGGACCTGGCG
GGCGACCCCGACTTCCGTGAGGTGCTGCGGCGGGTGCAGGAGGTCGTCAACGGTGCCCAG
CAGCACCAGGAGGTGCCCTTCGAGGTCCTCGTCGACGCGCTCCGGCCCGAGCGGTACCTG
TCGCAGAACCCGCTCTTCCAGGTCTGCTTCAACTTCCTGCCCGCCAGGGAGCTCAAGCCG
GGGGACGAGCTGGTCATCGAGGCGATCGAGGGCGTACGCATCGACACCGCCAAGTTCGAC
CTGTGGATCAGCGTCGTCGACTGCGCCGACGAACTCCTGGTGGAGGTCGAGTACAACCGC
GACGTCTTCGACCCCGGCACCGTACGCCGCCTGATGGACGCCTTCCGCGTGGTCTTGGAG
GCCGCCGCGGCCGGACCGGAGACGCCCGTCTCCCGGCTCCCCGTGCTCCCCGAAGCCGAC
CGCCGCCGGATCGTCGAGGAGTGGAACGACACCGCGCGGGCCTTCGACGGCGCCGAGCGC
TGCCTGCACGACCTGATCGCCGGCCAGGCCGCACGCACCCCCGACGCGCCCGCGGTCGTC
TTCGGCGGCGAAGAGCTCGGCTACGCGGAGCTCGACCGCCGCGCCAACCGGCTCGCCCAC
TGGCTGCGCGCCCGCGGCGCGGGCCCCGAGAGCACCGTCGCCGTCTGCGCCGAGCGCTCG
GTGGACCTGGTCGTCGCGCTGCTCGGCGTGCTCAAGTCGGGCGCCGCGTACGTGCCGATC
GACCCCGACCACCCCGTCAGGCGCCGCGCCTTCATGCTCGCCGACGCCGCTCCGCGGATC
GTCCTGACCCAGGAACACCTGCGGGACGCACTGCCGCCCACGGAGGCGGAGGTGCTCGCC
CTCGACACCCGCGCGGCGGAGCTCGCCGAGCAGCCCGAGGGCCCCGTGGCGCACGGCGCG
GGCCCCGACACGCTCGCCTACATGATCTACACCTCGGGGTCGACCGGTGAGCCCAAGGGC
GTCCTGAACACCCACCGCGGCATCGTCAACCGGCTCCTGTGGATGCAGGACCGCTACGGC
CTCGACGCCACCGACCGGGTGCTGCAGAAGACGCCGTTCAGCTTCGACGTCTCGGTGTGG
GAGTTCTTCTGGCCGCTGCTGACCGGCGCCACGCTCGTCGTCGCGGGACCCGACGAGCAC
AAGGACCCCGCCAGGCTCGCCGAGCTGATCGACGGTGAGCGCGTCACCACGGCCCACTTC
GTCCCGTCGATGCTCCAGGTCTTCCTCGGCCAGGACGGCCTCGCCGGGCGCTGCGCGGAC
CTGCGGCGCGTGGTGTGCAGCGGCGAGGCGCTGCCGTTCGCCCTCCAGGAGCGGTTCTTC
GCCAAGTTGCCCGGGACCGAACTGCACAACCTCTACGGCCCCACCGAGGCGGCCGTCGAC
GTCACCTCCTGGCAGTGCGTGCCCGGCGACGAGCGCGGCGTCGTGCCCATCGGCCGGCCC
ATCGCCAACACCCGCGTCCTCGTCCTGGACGAGCGCCTCAACCCGGTGCCGGTCGGCGTC
GTCGGCGAGATCCACATCGGCGGCGTGCAGGTGGCCCGCGGCTACCACAACCGGCCCGAG
CTGACCGAGGAGCGCTTCGTCCCCGACCCGTTCGGCGCCCCGGGCGAGCGGCTGTACAAG
ACGGGTGACCTGGCCAGGCTGCTGCCCGACGGGGCCATCGAGTACCGGGGACGCGCCGAC
TTCCAGGTGAAGGTGCGCGGCATCCGGATCGAGCCGGGCGAGGTCGAGGCCACCCTGACC
CGGCACCCCGGAGTCCTCGACGCCGCCGTCGTCACCCGCGACGACCCGCGCGCGGCGGGC
CACAAGCAGCTCGTCGCCTACGTCGTGCCCGACACCGCGCCCGCCGCCACAGCCCCCGGC
GAGGACCCGATGACCGAGCGGGTCGCCCAGTGGGCGGAGGTCTTCGACCAGGCCTACGCG
CAAGGCACCGACCCGCGCGAGGCCGACTTCAACATCGTGACCTGGAACAGCAGCTACACC
GGTGAGCCCCTGCCGGCCGAGGAGATGAGGGAGTGGGTCGACGGCACCGTCGAGCGCATC
CTCGCCCTCAAGCCCCGTCGGGTCCTGGAGATCGGCTGCGGCACCGGTCTGCTGCTCTCC
CGCGTCGCCCCGCACTGCGAGAGCTACCACGGCACCGACATCTCGTCGGCCGCCCTGGAC
TTCGTGCGCACCCGGCTGCTCGCGGACCGCCCCGAGCTGGCGAACGTCACCCTCTCGCAC
CGCGCCGCCGACCGGACCGCGGGCATCGGTGACGAGCCGTACGACCTGGTGATCCTCAAC
TCCGTCGCGCAGTACTTCCCCGACGGCGCCCATCTGCGCACCGTGCTCGGCCAGGCCGTC
GACAGCCTCGCGGGGAACGGCGCCGTCTTCGTGGGCGACCTGCGCAACCTCGCCCTGCTC
GACACCTTCCACACCGACGTCGAACTGAGCCGCGCGACGGCGAAGCTCTCCGTCGGCCGC
CTGCGCGGCCGCATCGCCCGCCGGACCCGGCAGGAACAGGAACTCCTCGTCCACCCGGCG
TTCTTCGCCGCCCTGCGCGAGGAGAACACCGCCGTCAGCGGCGTCGACGTACAGCTCCGC
CGGGGCCGCCACGACAACGAACTCACCCGGTACCGCTACGACGCCGTCCTGCACGTCACA
CCGTCCGCCCCCGGCCCGCAAACCGACGTCGTCACCATCGACTGGGCCGACTGCGGCGGT
CTCGCCGGGGTGCGCAGGCGCCTCGCCGACGAGCGGCCCGGGGCGCTCGCCGTGCTCGGC
GTGCCCAACGCCCGCCTCGGCGCCGTGAACGCCAAGCGGGACCGGCTGCGCGAGAGGGAC
GCCGAGGAGATCGTCGGCGAACTCGTCCGCGACACCGGCACCGACCCCGCCCACGTGGAC
CCCGAGCAGTGGTGGCGGCTCGGCGCGGAGACCGGACTGACCGTCACCGTCACCTGGATG
CCCGACGCCACCGACGGCAGCTACGCGGTCCTGCTCAGCCGCACCGGCACCCACCGCGTC
GACCTGCCCGCCTCCCCGGCGGACGGGCCGCCGCAGCTCACCAACGACCCCGCCTTCGAC
CGCGCGGGCACCGACCTGGTCCGTGACCTCCGCCGCCACCTCAAGGACAGCGTGCCGGAC
TACATGGTGCCCTCCGCGTTCCTGCCGCTGCGCGCCCTGCCGGTCGGCGTCAACGGCAAG
CTCGACCGCGACGCGCTGCCGCCGGTGCCCGACCACGCCGACACCGACGGCGCCGCCGCC
GAGCCCACCACCCCCACCGAACACCTCCTCGCCGAGCTGTGGGCGGAGGTGCTCGGCGTG
GACGACGTGGGCGTGCACACCAACTTCTTCGAACTCGGCGGCGACTCCATCCACACCATC
CACGTCGTCGCCAAGGCCAGGCAGCGCGGCCTGGAATTTGCCCCGCAGCTCGTCTTCCGG
CACGGCACCGTCGCCGCCCTCGCCGCCGCCCTCGACGAACGGGCCGCCACGGACACCGCC
GCTCCCGTGCGGCCCGCCGCCGGGCAGGACGCGGACACGGCGCTGAGCGAGCTGTCCGCG
GCACCCGGCGTGGTCGACGTCTACCCGCTCTCGCCCTTCCAGCAGTGGGCGCTCGGCGAG
TGGCGCGAGCACCCCGAGCCCGGCCTCTTCCTCGTGCACCGCATGCAGCTCCTGAAGGTC
TCCGGGTTCAGCGAGGACGTCTTCGTCGACTGCTTCCGGCAGCTCATCTCCGAGCACCCG
CTGCTGCGCACCACCTTCGCCTGGGAAGGCCTCACCGAACCGGTGCAGGTGGTGCACGAG
GAGGCCACCCCCGAGACGGCCTTCGCCGACTGGCGCGGCCTCGCGGGCCCCGAACAGGAC
ACCCGCCTGGAGACCTACCTCTCCGCGGACCGGGAACGCGGCGTCGACCTCGGCACCGCC
TCCGGGCTCCGCTACCTGGTCGCGCTCCTCGACGCCGACACCGCGCTCGTCGTGGTGAGC
CTGAACTACTTCTGCCTGGACGGCTGGAGCTTCGAGATCGTCACCGACAGGCTCCAGGAA
CTGCTCGACGCGGCGGCCACCGGCCGTGCCCCGAGCCCCGCACCCGAACGCCTGCCGTTC
AAGGAGTTCGTCGAGGGCGTACGCGCCCTGCCCGCACGGCCCGCGGAGGAGTACTGGCGG
CGCGCCCTCGCCGGCCTCACCCGCCCGACGCCCCTCTCCGAAGGCGTGCGCGCGAAGCTG
CCCGCACAACCGGCGGAGGACGGCTGCGCACGGCAGATCATCACCCTCGACCGCGACACC
ACCCTCGGCCTCCGCCGCCTCTCCCAGCGCGCCCACCTCCCGCTCAACGCCCTGTTCCAG
GGCGCCTGGGCGCTGGTCAACGCCGCGTACACCGGAACCGACGACGTCGTGCACGGCGTG
CTCCTCGCGGGGCGCTCCTCGCCGGTCGCCGACCCCGAGGCGCTCTCGACCACGGTCGGC
CCCGCCTTCAACATCCTGCCGCTGCGCACCCGCGTCGACCGCGAACGCGACACCGGCGCC
TTCCTCAAGGAGCTGTTCGGCGCGCTGGTGGAGATGGGCGGCCACGAGACCACCCCGCTC
GACACCGTGCTCGGCTGGAGCGACCTGCCGCCCGGCACGCTGCCCTGCGAGAGCTACATC
GTGTTCCAGAACGTCGGCGTGGACACCATGGAGCGCTCGGGCACCGCGTTCTTCGTCTCC
AAGATGGGCTTCCCGCTGCGCCTCGACGTCTTCCCCACCAACGTCGTCACCGTGCATCTG
TCCTACCACCGCGACCAGGTCACCGACGCCGCGGCGACCCGGCTGCTGCTCGGCCTCCGG
TCCGTCCTCGAAGCGACGCTCGACGGTCTCGACAGGCCCGTCGGCGACCTCGCCGCCGCC
GCTCTCGAGGAACGCGAGACCCCGTCCGGCCTGGGCATCTTCCACGAGGGCGAGTTCCGC
GTCGCGGACATACGCGAACAGCAGGGCGGTGAACGCGCTTGA
[12] C46..399
[12] A528..930
[12] serine696..800
[12] MT1029..1128
[12] PCP1426..1492
[12] C1526..1833
[12] C136..1197
[12] A1582..2790
[12] serine2086..2400
[12] MT3085..3384
[12] PCP4276..4476
[12] C4576..5499

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000873 AMP-dependent synthetase/ligase (Domain)
 [528-930]  9.69999999999989e-127 PF00501
PF00501   AMP-binding
IPR001242 Condensation domain (Domain)
 [46-339]  1e-74 PF00668 [1526-1833]  3.99999999999998e-41 PF00668
PF00668   Condensation
IPR006162 Phosphopantetheine attachment site (PTM)
 [1451-1466]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [1418-1496]  3.7e-26 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [1426-1492]  PS50075
PS50075   ACP_DOMAIN
 [1430-1491]  2.80000000000001e-12 PF00550
PF00550   PP-binding
 [1419-1542]  1.29999924468179e-20 SSF47336
SSF47336   ACP_like
IPR010071 Amino acid adenylation domain (Domain)
 [528-930]  TIGR01733
TIGR01733   AA-adenyl-dom
IPR013217 Methyltransferase type 12 (Domain)
 [1029-1127]  2.3e-12 PF08242
PF08242   Methyltransf_12
IPR020845 AMP-binding, conserved site (Conserved_site)
 [648-659]  PS00455
PS00455   AMP_BINDING
SignalP No significant hit
TMHMM No significant hit