close all open/close all

CDS information : Oxzol_00180


close this sectionLocation

Organism
StrainJA3453
Entry nameOxazolomycin
Contig
Start / Stop / Direction62,176 / 65,349 / + [in whole cluster]
62,176 / 65,349 / + [in contig]
Location62176..65349 [in whole cluster]
62176..65349 [in contig]
TypeCDS
Length3,174 bp (1,057 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.4 Other
Productputative trans-acting acyltransferase
Product (GenBank)malonyl CoA-ACP transferase
Gene
Gene (GenBank)ozmM
EC number
Keyword
  • trans AT
  • malonyl-CoA
Note
  • The N-terminal position was modified from original INSDC entry.
Note (GenBank)
Reference
ACC
PmId
[20406823] Oxazolomycin biosynthesis in Streptomyces albus JA3453 featuring an "acyltransferase-less" type I polyketide synthase that incorporates two distinct extender units. (J Biol Chem. , 2010)
Related Reference
ACC
Q8GGP5
PmId
[12598647] Type I polyketide synthase requiring a discrete acyltransferase for polyketide biosynthesis. (Proc Natl Acad Sci U S A. , 2003)

close this sectionPKS/NRPS Module

13
malonyl-CoA
malonyl-CoA
AT6..274
AT336..604

close this sectionSequence

selected fasta
>putative trans-acting acyltransferase [malonyl CoA-ACP transferase]
MSRPVVFQFSGQGSQYSGMGSALYETEPVFRRVMDRLDAAASGELGESVLAALYAPGRGR
AEPFDDIAFTHPAIVMVELAAAETLIASGIRPDLLLGASLGEFTASVLAGVLDADACLRI
LVRQAAAVRDAPRGGMLAVLDDVALHARLPLLRERTEIAARNYPGHFVLAGAHEDLVAAE
EELRARKVVCHRVPVPYAFHSRLMDSGEPLFRSAMAGTELRPPRLPVISCATGGQVERVT
VDHLWRATRLPIEYAGTLAALERRGPFQYVDLGPSGTLHNFARNGLPASSRSRSLPLLSP
LGDDTRSLAAVRAAVPATARPAIPATPLSEDGVMKVYGFPGQGSQAKGMGKDLFEEFPEE
TALADSVLGHSIRELCVEDPRRELKLTRFTQPALYVVSALAWLRERRENPVPPDFLVGHS
LGEYVALFAAGSFDFETGLRLVARRGELMSRADGGRMAAVLKCDLETVEGALAGHGLTGL
DIANHNAPGQFVIAGPTEQITAAKPVFEGLGAHYVQLNVSAPFHSRYLRDTAEEFGRYLE
GFTLRDPAVPVIANVDARPYRPGEVARQLARQIASPVRWTDTIRYLMGLGDFEFVELGPG
RVLGKLVAKIRAEAEPLVPAKAPATGATAVQPVAARPGGGPAALGAATFRERYGLRYACL
AGSMYGGVSGAELLVRLAKAGGMGFFGSGGLSPDDVGAGLDAVRAGLGADGAYGANLLHR
HTDPHHEAALVDLFLRKGVRTVEASGFLRITPALVKYRLSGGRVLAKVSSTDMATAFLAP
APPAIVRELVDSGQVSESAAARYADVPLADDLCVETGSGWYEAVGSLATLLPAVLRLRDA
AAGAGPRVHVGAAGGIGCPEAAAAAFLLGADFLLTGSINQCTPEADTSTAVKDLLQSLDV
HDVALAPAAEMFELGVRAQVVKRGVFLPARAGKLHDLWRRHDSLDAVDAPTRRQIEEKFL
RAALPTAAASGGDPKRHMADAFRSYLDRGFDLARRGEPGRTVDYLVYCGPAMGAFNSWAR
GTVLESWQSRHVDAITEELMTGTAALLRERAAAFAAL
selected fasta
>putative trans-acting acyltransferase [malonyl CoA-ACP transferase]
TTGAGCCGCCCGGTCGTCTTCCAGTTCTCCGGACAGGGCTCGCAGTACAGCGGGATGGGA
TCCGCCCTGTACGAGACGGAACCGGTCTTCCGCCGCGTCATGGACCGCCTCGACGCGGCG
GCGTCCGGCGAACTCGGCGAGTCCGTCCTCGCGGCGCTCTACGCGCCGGGCCGCGGCCGA
GCCGAACCGTTCGACGACATCGCGTTCACCCACCCGGCGATCGTCATGGTCGAACTCGCC
GCCGCGGAGACCCTCATCGCCTCCGGCATCCGGCCCGACCTGCTGCTCGGCGCCAGCCTG
GGGGAGTTCACCGCGTCCGTGCTCGCGGGCGTCCTCGACGCCGACGCGTGTCTGCGGATC
CTGGTCCGCCAGGCCGCCGCGGTGCGTGACGCCCCGCGCGGCGGCATGCTCGCCGTCCTC
GACGACGTGGCGCTCCACGCGCGGCTCCCGCTGCTGCGCGAGCGCACCGAGATCGCCGCC
CGCAACTATCCGGGACACTTCGTCCTCGCGGGCGCCCACGAGGACCTGGTGGCCGCCGAG
GAGGAACTGCGGGCCCGCAAGGTGGTGTGCCACCGCGTCCCCGTCCCGTACGCCTTCCAC
TCGCGCCTGATGGACTCCGGCGAGCCGCTGTTCCGCTCCGCCATGGCAGGCACCGAGCTG
CGACCGCCGCGGCTCCCCGTGATCTCCTGCGCGACCGGCGGCCAGGTCGAGCGTGTCACG
GTCGACCACCTGTGGCGGGCGACCCGGCTGCCCATCGAGTACGCCGGCACGCTGGCCGCC
CTCGAACGCCGCGGCCCCTTCCAGTACGTGGACCTCGGCCCCTCCGGCACCCTGCACAAC
TTCGCCCGCAACGGCCTGCCCGCGTCATCGCGCTCCCGGTCGCTGCCGCTGCTGAGCCCA
CTGGGTGACGACACCCGCTCCCTGGCCGCCGTGCGCGCCGCCGTACCGGCCACCGCGCGC
CCCGCGATCCCCGCAACCCCCCTATCCGAGGACGGCGTCATGAAGGTGTACGGATTCCCC
GGCCAGGGCAGCCAGGCCAAGGGCATGGGCAAGGACCTCTTCGAGGAGTTCCCCGAGGAG
ACCGCGCTCGCCGACTCGGTGCTCGGCCACTCGATCCGCGAGCTGTGCGTCGAGGACCCC
CGCCGCGAGCTGAAGCTCACGCGGTTCACCCAGCCCGCCCTCTACGTCGTCAGCGCCCTC
GCCTGGCTGCGCGAGCGGCGCGAGAACCCCGTACCGCCCGACTTCCTCGTCGGCCACAGC
CTCGGCGAGTACGTGGCGCTGTTCGCCGCCGGGTCCTTCGACTTCGAGACCGGCCTCCGC
CTGGTCGCCCGCCGCGGCGAGCTGATGAGCCGCGCCGACGGCGGGCGGATGGCGGCGGTC
CTCAAGTGCGACCTCGAAACCGTTGAGGGAGCCCTGGCCGGACACGGCCTGACCGGTCTG
GACATCGCGAACCACAACGCGCCCGGCCAGTTCGTGATCGCCGGGCCCACCGAGCAGATC
ACCGCCGCCAAGCCGGTCTTCGAGGGCCTCGGCGCGCACTACGTGCAGCTCAACGTCAGC
GCCCCCTTCCACTCCCGTTATCTGCGGGACACCGCGGAGGAGTTCGGCCGCTACCTGGAG
GGGTTCACCCTGCGCGACCCCGCCGTCCCGGTCATCGCCAACGTCGACGCCCGGCCCTAC
CGGCCCGGCGAGGTGGCGCGGCAGCTCGCCCGCCAGATCGCCTCCCCCGTCCGGTGGACC
GACACGATCCGCTACCTCATGGGCCTGGGCGACTTCGAGTTCGTGGAATTGGGGCCGGGA
CGGGTGCTCGGCAAGCTCGTCGCGAAGATCAGGGCGGAGGCCGAGCCGCTCGTACCGGCG
AAGGCGCCCGCGACCGGGGCCACTGCCGTGCAGCCGGTGGCCGCGCGGCCCGGCGGTGGT
CCCGCCGCCCTCGGGGCCGCCACGTTCCGCGAACGCTACGGCCTGCGGTACGCCTGCCTC
GCGGGCTCCATGTACGGCGGTGTGTCCGGTGCGGAACTCCTCGTGCGACTCGCGAAGGCG
GGCGGGATGGGCTTCTTCGGCAGCGGCGGGCTCTCCCCGGACGACGTCGGGGCGGGGCTC
GACGCGGTGCGCGCCGGACTCGGGGCCGACGGAGCCTACGGCGCCAACCTGCTGCACCGG
CACACCGACCCGCACCACGAGGCGGCGCTGGTCGACCTCTTCCTGCGCAAGGGCGTCCGC
ACCGTCGAGGCCTCCGGCTTCCTGCGGATCACCCCGGCCCTGGTGAAGTACCGGCTCAGC
GGCGGCCGGGTGCTCGCCAAGGTGTCGAGCACCGACATGGCCACCGCCTTCCTCGCGCCC
GCGCCGCCCGCGATCGTCCGGGAACTGGTGGACTCGGGGCAGGTCTCCGAGTCGGCCGCC
GCCCGGTACGCGGACGTGCCACTGGCCGACGACCTCTGCGTGGAGACCGGCTCCGGCTGG
TACGAGGCCGTCGGCAGCCTCGCCACCCTGCTGCCCGCCGTCCTCCGCCTGCGCGACGCC
GCGGCCGGTGCGGGGCCGCGGGTGCACGTGGGCGCCGCGGGAGGCATCGGCTGCCCGGAG
GCGGCCGCCGCCGCGTTCCTGCTCGGCGCGGACTTCCTGCTCACCGGATCCATCAACCAG
TGCACGCCCGAGGCGGACACCAGCACGGCCGTCAAGGACCTGCTCCAGTCGCTCGACGTC
CACGACGTGGCCCTCGCGCCCGCCGCCGAGATGTTCGAGCTCGGCGTACGCGCGCAGGTC
GTCAAGCGCGGCGTGTTCCTGCCGGCGCGCGCCGGAAAGCTGCACGACCTGTGGCGGCGC
CACGACTCCCTCGACGCCGTCGACGCGCCGACCCGCCGCCAGATCGAGGAGAAGTTCCTG
CGCGCGGCGCTGCCCACGGCAGCCGCCTCCGGCGGTGACCCCAAGCGGCACATGGCCGAC
GCCTTCCGGAGCTACCTCGATCGCGGCTTCGACCTCGCGCGGCGCGGTGAACCCGGCAGG
ACCGTCGACTACCTCGTCTACTGCGGGCCCGCCATGGGCGCCTTCAACTCCTGGGCGCGC
GGCACCGTCCTGGAGTCCTGGCAGTCGCGCCACGTCGACGCGATCACCGAAGAGCTGATG
ACCGGGACGGCGGCGCTGCTGCGCGAACGCGCCGCCGCGTTCGCCGCGCTCTGA
[13] AT6..274
[13] malonyl-CoA197..201
[13] AT336..604
[13] malonyl-CoA521..525
[13] AT16..822
[13] malonyl-CoA589..603
[13] AT1006..1812
[13] malonyl-CoA1561..1575

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [196-299]  5.3e-49 G3DSA:3.40.366.10 [519-613]  5.6e-54 G3DSA:3.40.366.10
G3DSA:3.40.366.10   no description
IPR004136 2-nitropropane dioxygenase, NPD (Domain)
 [657-904]  6.9e-12 PF03060
PF03060   NMO
IPR004410 Malonyl CoA-acyl carrier protein transacylase, FabD-type (Family)
 [336-612]  1e-88 TIGR00128
TIGR00128   fabD: malonyl CoA-acyl carrier protein transacylas
IPR013785 Aldolase-type TIM barrel (Domain)
 [649-906]  4.1e-21 G3DSA:3.20.20.70
G3DSA:3.20.20.70   no description
IPR014043 Acyl transferase (Domain)
 [6-274]  6.7e-41 PF00698 [336-604]  5e-29 PF00698
PF00698   Acyl_transf_1
IPR014179 PfaD family protein (Family)
 [642-1050]  3.8e-140 TIGR02814
TIGR02814   pfaD_fam: PfaD family protein
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [4-305]  6e-45 SSF52151 [333-636]  4.1e-57 SSF52151
SSF52151   FabD/lysophospholipase-like
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [132-196]  6.3e-11 SSF55048 [453-520]  6.4e-17 SSF55048
SSF55048   Probable ACP-binding domain of malonyl-CoA ACP transacylase
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [9-322]  8.6e-38 SM00827 [339-638]  3.4e-29 SM00827
SM00827   Acyl transferase domain in polyketide syntha
SignalP No significant hit
TMHMM No significant hit