close all open/close all

CDS information : Oxzol_00190


close this sectionLocation

Organism
StrainJA3453
Entry nameOxazolomycin
Contig
Start / Stop / Direction65,423 / 80,338 / + [in whole cluster]
65,423 / 80,338 / + [in contig]
Location65423..80338 [in whole cluster]
65423..80338 [in contig]
TypeCDS
Length14,916 bp (4,971 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)PKS
Gene
Gene (GenBank)ozmN
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[20406823] Oxazolomycin biosynthesis in Streptomyces albus JA3453 featuring an "acyltransferase-less" type I polyketide synthase that incorporates two distinct extender units. (J Biol Chem. , 2010)

close this sectionPKS/NRPS Module

2
3
4
KS18..394
DH612..781
KR1129..1314
ACP1400..1468
KS1526..1897
DH2128..2293
KR2652..2836
ACP2954..3022
KS3064..3443
DH3687..3853
KR4184..4364
MT4631..4736
ACP4848..4916

close this sectionSequence

selected fasta
>polyketide synthase [PKS]
MSSHDATDATDATDVSGNDIAIVGMAGRFPGADSVGEFWELLRSGREGITRFSDEELAAA
GVPAALRADPAYVRAHGILPDVDLFDTGFFEFTPAEAEVIDPQHRLFLESCHTALEDAGY
DPRRYDGLISVYGGAAINTYLQRHVLPSIDQTATSDHFRVMVGNDKDFLATRVSYKLDLR
GPSYSVQTACSTSLVAIHLACQGLINGECDMALAGGVTVKLPQARGYLYEEGAILSPDGR
VRTFDAEAGGTVLGNGVGIVVLKLLADALDAGDTIHAVIKGTATNNDGSLKVSYAAPGKE
GQAAVVAEAHAVSGTEPESVTYVEAHGTATRLGDPVEVAALTDAFRRGTSDTGFCAIGSL
KSNVGHLDAAAGVAGVIKTALMLRHRSLVPTLNHERPNPAIDFAATPFYVNTETRPWAGE
GPLRAGVSSFGIGGTNAHAILQEAPEQGPTEPSPRAEQLLVLSARTRTALDTLTDDLADH
LEANPGTDLADAAHTLAVGRRAHRHRRAVICADPARAVRALRERAEPDCATAEAGAAAGT
GAFTPGPGLSGRALLEAVRTAWLDGAEVDWARFYAGERRRRVPLPTYPFEGRRVWLEPPT
DTRGTAAAEAPHPLLGANVSTLAEHRYATELTGDEFFIADHRVEGRAIMPAVGYLEMARA
AGALSLPAGPPSLTRVSFERPLSFARGPRTVHVELTPHGDAARFAITGRAPGSGGEPEVF
ARGELSATAPAPVPHAPAPHVPAPVDPAAVTARCPDVLAADDLYDLLRARGLDYGPAMRS
LRELRRGRDEALGVLELSGAARAAGDADAFVLHPSLLDAALHAVVGLLAARADEGITFLP
LALGRLDVLAPLPRHCLAHVTLPAHGTGEKQTKADIDLLDTEGRLLARLRELSVRTLRDE
RGEPGTALFAGGWESADPAARGALPPGPRLLLTHDPAHRAELLEALRDAGDAEPAVVLAT
PGDAFARVDDDHYTVDPARQEDFTALLDRLAGTGRTPSAVLHTWCAAEDGHDGPRSVFAL
TKALLARRGGDRTVLLVAHRTDAHGARPAEAALAGFGRGVTLENPRLTHRLVGLDAGTPL
LPALVGELARTGDGETETRHSGGTRHVRRHRRVAETGTEAGTAPTLGDGACLITGGAGSL
GLTLAAHLAGRTGTPLVLLGRSAPSPEAAERVEALRAAGHDVTFRRADVTDEAAVREALD
AVRAEHGAIRGVVHAAGTSADAYLLHKSWEEFTGVVAPKALGAVHLDRLTADDPLDLFVC
FSSVAAAFGNAGQSDYAYANAFLDAFAERRRALVAAGSRSGRTLSLGWPLWLAGGMSQDD
DAVHALRHRTGLSPMPTDAGLAAFDEALRQGGGALLVGHGDLDRVAAALTPVPAPAPARR
AVTAGAADAERAGTDLTEWAGAFLRKLLAERTKLDPDELDLRVPFDRYGIDSLVITRLNT
ELERHFDDLPKTLFFEYATLQELAEYFAAEYADRLGELAAAEQPDLAPAPTPASDHTAPE
VSGPEERSGSAAGATADGTAMDDATAVAVIGLSGRYPMADDVDEFWANLAAGRDCVTEIP
ADRWDHDRYFDADPSAPGRASTRWGGFLRDVDRFDPLFFGISPREAELMDPQERLFLQNA
WHVFEDAGYRRDELSGRPVGVFVGVMYGEYQLYGAADAERGGIRVTGSSFASIANRVSYT
LGLNGPSIALDTMCSSSLTAIHLACESLRTGESEAAVAGGVNLSLHPYKYVFLSQGRFVS
ADGRCRAFGAGGTGYVPGEGVGAVLLKPLAAAERDGDHIYGVIRGHAVNHGGRTNGYTVP
SPHAQADAVRRALRGAGLEPADIGYVEAHGTGTSLGDPIEIAGLAKAFGTPKEDGPRWPI
GSVKSNIGHLESAAGIAGLTKVLLQFRHRRLVPSLHADEPNPNIDFGRAPFRVQREAADW
PEPAGADGAVPRRAGLSSFGAGGSNAHLVVEEYRAGPERPERPVAGQRFACPLVFPLSAR
DTERLGVYADRLADFAERAHVRAEDLAHTLQHGREVMEERLAVVAEDGAALVGALRAFRA
GTPCPGLLTGASAGSGQPEEQGPAFGAAVRWTREGSADWPGTAPGGPEPRRVPAPHYPFA
RERYWVPAADRSAVPGGPAGISGPARLHPLLDANESTLDEIRFRRTFLADEPLVRDHVIE
GRALLAGAVCLEMARAAAGLAGLDDALRVRDVLWGRPVVIEDGGPADVYVGLTRTGENRG
PADGELAFTVWTSRGGERTVHVRGTVHAGPAAPAGAVDLDALRASCPEVRDGAAVRAAYD
RARFAYGPAFDVIEEVRFGEGGALLTLALPEPDGATALPPALLDGALRACHWADRPSPEE
SDGLAVPFNLGTLEIRAPRGTLPRRCYAHAVPARRGGEPSGLRRFDVRVLDESGAELVRV
EDFGGRHLARDEAPFFYEQVWRDEDVVAGAAPGSDAVLVLGDGDEVARGLAGRTGVRRVV
DVRAAAGFARTGPDRYAVDPECPGDFERLLAELARDGVRSLDVVHLWGLTAEPVGYGREG
ASARAEAALDGAFARGLHSLRSLALALHAVRHPGRVRCAYVLADPERGPRPDQEAVAGFA
LSLTGVLPRFELFTVACADGLDLPGLLAAELTQGGRPAGAEIRHAATGRQVRVLRRAEET
RTAAAVPLKRGGTYLITGGTGGIGLELARHLAATYAARLVLISRSAGRPPAREAADGLAA
LGAEVLLVAADTADPSGMRAAVARAKERFGHLDGVFHLAGAADQCSLLDAEAARFTGLLS
VKAHGVRLLDALTADEPLDLFVVFSSIASVVGDFGACAYAAANRFLDSYAEERDLRVREG
RASGRTLSAAWPLWRIGGVDALMGEQERTGYRHRTGMREFTGEEGLRALDLAWRTGLVRL
VPAVGDPDTVDAALLPRPAAGARADSGAATAATRTDETAVPASAVPHAAGPVAVTAVTRT
NGAAVPASALLDRMRDHVRALLGQVLGLSVERIDDHTALDAYGLDSVLVMETNEHLDRDF
PGARGTLLFEYRTVHDLAAHLLAEHPDAARRLFPAETAPVVLPVSVEERPAAPAAPPRAP
ADDDDIAVIGIGGRYPHARDLTEFWENLRRGHDAVTEVPGDRWDADAHFDGDHTAPGSSY
GKWGGFLEDVDAFDSLFFRIPPSQAKLMDPQERLFLEAAWSALENAGYPPSRLPRPRFGG
QGRDVGVFAGVMWGDYAQLAAEESVRGNHHTVLTNRSAIANQVSYFGDFRGPSVVVDTAC
SASLVALHQACESVRRGECRYALAGGVNVSAHPSKYAHLSRMRMLSTDGRCRSFGAGGDG
YVPGEGVGAVLLKRLSEAVADGDHIHAVIKATAVNHGGRTSGYTVPSPQAQQALIEETLD
RAGIDPRTIGYVEAHGTGTALGDPIEHTALQQAFAGVVRDAGAIALGSVKSNIGHLEGAA
GIAGLTKAVLQLSHGQLVPSLHSEETNPIIDFATSPFRVQRELADWARPVIETDGVRVEQ
PRRASVSSFGAGGTNAHVVLEEYRAPEGSAATASGGHELLVLSARGPERLRAYAAEMAAH
LRRERPALADTAHTLRVGREALPERLAFPAADIDDAADKFAAFADGASVPSAITGNADGH
TALAEVFTDGAGPEFLRTLAAAGDDTRLARLWVSGAFAEWTALHGRAAGRCRTVPLPGYP
FERPRHWLPVTRTELADVPRPPGEKEARPEPPRAADRTLTLDPADPVVRDHVVGGRAVLP
GVGHLDLVVRALGEDAARVFRDVRWLTPLVVPDTGAEVTLTTRPEAALTTRPEAVGAARP
EDGPALGYRLTASSADASPVHSLGQVVATAPDRPAPLSVDLLKADCPRRVSHEELYEGLR
RRGLPYGPHFRRVAQAWTGDRTALARLHRPEECSDAARGPLDPGTLDAALHPLALLLADE
GASGRPLLPFAADRVEIHAPLPDEGWSHVRDLGSRRFDVTVTDAGGRVCVRVTGLALREA
KPEPSIDYRPRWAVAPPAVADAVAPRAVLTVTGEEGAALADALREAHPDAEHVRLSIGEG
GLDERATAELLDRVPHIDLVYFLDVGGPHGPAADRRARRAAQDRGTVALYRLVRGLDRAG
LLDGPLALKVLTTDALPLGDDDAVRPEAAGPIGFCEVAAKEFPRLSAACLDVRREELGDG
VRALVREPVRAKVRPVSLRGGVRRIRRLEAVAPAAAPTRFRERGVYLVIGGLGVLGRDTA
RYLARTYRARLVLVGRGAVDERRRADLAAIEELGAEVSYVPCDAGDPVALRQVIDETKDR
FGALHGVIHSAMVLVDKPIRRLAEAELRTALDAKADTVWSMFRALRGERPDFVLLYSSAV
TFEGNHGQAGYAAGCHVADAWALAGARTAPYPVRTVNWGYWHAAGDTHRESVLSRFAAAG
IRPIGAEEGMAAVERVLSGTLPQALVVKADQRILAGLGVDTDTVLRAQPELPASSAPLAP
GPGSTEPYTRSGGAAAETETFARRLLVGALRSMGVLRGPGERYTRDGLRARLGVVEAQER
LLGLLVDVLLRGGHLRAEGPELVTTDLVVDPEVLRCVERPEEAAAGLTARHPDAGAVTAL
LLRCVEALPEVLTGRRGHLDVLFPGGSFDLVEAVYAGDPVTDRCNEQVAGAVLRYVTERL
RSRPGDRVRVLEVGAGTGGTSARVLRALATAGLGDHVEYLYTDVSEGFVRHGRKRFGAGH
PFADFRALDIERVPEEQGFESGGYDLVLGSNVFHATGRIDRTLAHTKRLLGTNGVLVLNE
GVELRDQMSLIFGLATGWWLFEDAEYRLPHSPLLSTTAWRDVLAHNGFRGVTEAPRPDGG
THQCVLVAESDGFVPVTAAAPGPPVPAASSAPAAVSTVPAGPDPVRDAERRVKAVFARVL
EMEEDLLDARATFENYGVDSLVVLSLTKELEQEYGPLPSTLLFEHITIERLARHLAATGA
AGTAAGTAAGPARAAEPEAGIEQLVDSLSDTEVDSLLRQLGSVLQKQEEQR
selected fasta
>polyketide synthase [PKS]
GTGAGTTCGCACGACGCCACCGATGCCACCGACGCCACCGACGTGTCCGGGAACGACATC
GCCATCGTCGGCATGGCCGGGCGCTTCCCCGGCGCCGACAGCGTGGGGGAATTCTGGGAG
CTGCTGCGCTCGGGCCGCGAGGGCATCACCCGCTTCAGCGACGAGGAGCTCGCCGCCGCC
GGAGTGCCCGCCGCGCTGCGCGCCGACCCCGCGTACGTACGGGCCCACGGCATCCTGCCG
GACGTCGACCTGTTCGACACCGGCTTCTTCGAGTTCACGCCCGCCGAGGCCGAGGTCATC
GACCCCCAGCACCGGCTCTTCCTGGAGAGCTGCCACACGGCCCTGGAGGACGCGGGTTAC
GACCCGCGCCGCTACGACGGGCTGATCAGCGTCTACGGCGGCGCCGCCATCAACACCTAC
CTCCAGCGGCACGTCCTGCCGAGCATCGACCAGACCGCCACCTCCGACCACTTCAGGGTC
ATGGTCGGCAACGACAAGGACTTCCTCGCCACCCGCGTCAGCTACAAGCTCGACCTGCGC
GGCCCCAGCTACAGCGTCCAGACGGCGTGCTCGACCTCGCTCGTGGCCATCCACCTCGCC
TGCCAGGGACTCATCAACGGCGAGTGCGACATGGCGCTCGCGGGCGGCGTGACCGTCAAA
CTGCCGCAGGCGCGCGGCTATCTGTACGAGGAGGGCGCGATCCTCTCCCCGGACGGGCGG
GTCCGCACCTTCGACGCGGAGGCCGGCGGCACCGTACTCGGCAACGGGGTGGGCATCGTC
GTCCTCAAGCTCCTGGCGGACGCCCTCGACGCCGGGGACACGATCCACGCGGTGATCAAG
GGCACCGCCACCAACAACGACGGTTCTCTGAAGGTCAGTTACGCCGCTCCCGGCAAGGAG
GGCCAGGCTGCCGTCGTCGCCGAGGCGCACGCCGTGTCGGGCACGGAACCGGAGAGCGTC
ACCTACGTCGAGGCACACGGCACCGCGACCCGGCTCGGCGACCCCGTGGAGGTGGCCGCG
CTCACCGACGCCTTCCGCCGCGGCACGTCGGACACCGGCTTCTGCGCCATCGGCTCGCTC
AAGTCCAACGTCGGCCACCTGGACGCCGCCGCGGGCGTCGCCGGAGTGATCAAGACGGCG
CTCATGCTGCGCCACCGCTCCCTGGTGCCCACCCTGAACCACGAACGGCCCAACCCCGCC
ATCGACTTCGCCGCCACCCCCTTCTACGTCAACACGGAGACCCGGCCGTGGGCGGGGGAG
GGGCCGCTGCGCGCCGGGGTGAGTTCCTTCGGCATCGGCGGGACCAACGCGCACGCGATC
CTCCAGGAGGCCCCCGAGCAGGGCCCGACCGAACCCTCCCCGCGCGCCGAACAGCTCCTG
GTGCTCTCCGCCAGGACCCGCACCGCGCTCGACACCCTCACCGACGACCTCGCCGACCAC
CTGGAGGCCAACCCCGGCACGGACCTCGCCGACGCCGCCCACACCCTCGCGGTGGGCCGC
CGGGCCCACCGCCACCGCCGCGCCGTGATCTGCGCCGACCCCGCCCGGGCGGTACGCGCC
CTGCGCGAGCGCGCCGAGCCCGACTGCGCCACGGCTGAGGCCGGAGCGGCAGCCGGCACA
GGGGCGTTCACACCCGGCCCCGGGCTCTCGGGCCGCGCGCTCCTGGAGGCCGTGCGCACC
GCCTGGCTCGACGGCGCCGAGGTGGACTGGGCGCGGTTCTACGCGGGTGAGCGGCGGCGC
CGCGTTCCGCTGCCGACGTACCCCTTCGAGGGCCGCAGGGTCTGGCTCGAACCGCCCACG
GACACGCGGGGCACAGCCGCCGCGGAGGCGCCGCACCCGCTCCTCGGCGCCAATGTCTCG
ACCCTGGCCGAGCACCGCTACGCCACCGAGCTGACCGGCGACGAGTTCTTCATCGCCGAC
CACCGGGTCGAGGGCCGGGCCATCATGCCCGCCGTCGGGTACCTGGAGATGGCGCGCGCC
GCGGGCGCCCTGTCCCTGCCCGCGGGCCCGCCGTCCCTCACCAGGGTCTCCTTCGAACGG
CCGCTGTCCTTCGCGCGGGGACCGCGTACGGTGCACGTCGAGCTGACCCCGCACGGGGAC
GCGGCCCGCTTCGCGATCACCGGCCGGGCACCGGGAAGCGGCGGTGAGCCGGAGGTCTTC
GCCCGCGGCGAACTGTCCGCCACCGCCCCCGCCCCGGTACCCCACGCGCCTGCGCCCCAC
GTCCCGGCACCCGTTGACCCGGCGGCCGTCACCGCCCGCTGCCCCGACGTGCTCGCCGCG
GACGACCTCTACGACCTGCTGCGGGCCCGCGGTCTCGACTACGGCCCGGCGATGCGGTCC
CTGCGCGAGCTGCGCCGCGGCCGTGACGAGGCCCTCGGCGTCCTCGAACTGTCCGGTGCC
GCCCGCGCGGCGGGGGACGCCGACGCCTTCGTCCTGCACCCCTCGCTGCTCGACGCCGCG
CTGCACGCGGTGGTGGGCCTGCTCGCCGCCCGCGCGGACGAAGGCATCACCTTCCTGCCC
CTGGCCCTCGGCCGTCTCGACGTGCTCGCGCCGCTGCCGCGGCACTGCCTCGCCCACGTC
ACCCTGCCCGCGCACGGCACCGGGGAGAAGCAGACCAAGGCCGACATCGACCTCCTCGAC
ACCGAGGGACGGCTGCTGGCCCGCCTGCGCGAGCTGTCCGTCCGTACGCTCCGCGACGAA
CGGGGCGAGCCGGGGACCGCCCTCTTCGCCGGCGGCTGGGAGAGCGCCGACCCCGCGGCC
CGGGGCGCTCTGCCCCCGGGCCCCCGGCTCCTCCTGACGCACGACCCCGCCCACCGTGCC
GAGCTGCTCGAAGCCCTGCGCGACGCCGGTGACGCGGAGCCCGCGGTGGTCCTCGCGACC
CCCGGCGACGCGTTCGCACGGGTCGACGACGACCACTACACCGTGGACCCGGCCCGCCAG
GAGGACTTCACCGCGCTCCTCGACCGGCTCGCCGGGACGGGCCGCACCCCCTCCGCCGTG
CTGCACACCTGGTGCGCGGCCGAGGACGGCCACGACGGCCCGCGCTCGGTCTTCGCCCTG
ACCAAGGCGCTCCTCGCCCGCCGCGGCGGCGACCGCACCGTGCTGCTCGTCGCCCACCGG
ACCGACGCGCACGGCGCGCGCCCCGCCGAGGCCGCCCTCGCGGGCTTCGGACGCGGCGTC
ACGCTGGAGAACCCGCGCCTCACCCACCGCCTGGTCGGCCTGGACGCCGGGACGCCGCTC
CTGCCCGCACTGGTCGGCGAACTCGCCCGCACGGGCGACGGGGAGACCGAGACCCGGCAC
AGCGGCGGCACCCGGCACGTACGGCGCCATCGCCGCGTGGCCGAGACCGGGACCGAGGCC
GGGACCGCCCCGACGCTCGGGGACGGCGCCTGCCTGATCACGGGAGGCGCGGGCAGCCTC
GGCCTCACGCTGGCCGCGCATCTCGCCGGGCGCACCGGAACCCCACTCGTCCTCCTCGGC
AGGAGCGCGCCCTCCCCCGAAGCCGCGGAACGCGTCGAGGCCCTGCGGGCGGCCGGGCAC
GACGTCACCTTCCGCCGCGCGGACGTCACCGACGAGGCAGCCGTGCGCGAGGCCCTCGAC
GCCGTCCGTGCCGAGCACGGGGCGATACGCGGGGTCGTGCACGCGGCGGGCACGTCGGCC
GACGCCTATCTGCTGCACAAGAGCTGGGAGGAGTTCACCGGGGTCGTCGCGCCCAAGGCG
CTCGGCGCGGTCCACCTCGACCGGCTCACCGCCGACGACCCGCTGGACCTCTTCGTCTGC
TTCTCCTCCGTCGCCGCCGCGTTCGGCAACGCGGGCCAGAGCGACTACGCGTACGCCAAC
GCCTTCCTCGACGCCTTCGCCGAGCGCCGTCGCGCGCTGGTGGCCGCGGGCAGCCGCTCC
GGCCGCACGCTCTCCCTCGGCTGGCCGCTCTGGCTGGCGGGCGGAATGAGCCAGGACGAC
GACGCGGTCCATGCCCTGCGGCACCGCACCGGCCTGTCCCCGATGCCCACGGACGCCGGG
CTCGCCGCCTTCGACGAGGCGCTGCGGCAGGGCGGCGGCGCACTGCTCGTCGGCCACGGG
GACCTGGACCGCGTCGCGGCGGCACTGACGCCCGTGCCCGCACCGGCCCCCGCGCGCCGG
GCCGTGACCGCGGGCGCGGCGGACGCCGAGCGGGCGGGCACCGACCTGACCGAGTGGGCC
GGGGCCTTCCTGCGGAAGCTGCTCGCCGAGCGCACGAAGCTCGACCCCGACGAACTCGAC
CTGCGCGTGCCGTTCGACCGCTACGGCATCGACTCCCTGGTCATCACCCGGCTCAACACG
GAGCTCGAACGGCACTTCGACGACCTGCCGAAGACCCTGTTCTTCGAGTACGCCACGCTG
CAGGAGCTGGCGGAGTACTTCGCGGCGGAGTACGCGGACCGGCTCGGCGAACTGGCGGCG
GCGGAGCAGCCCGACCTCGCGCCCGCGCCCACGCCCGCCTCGGACCACACCGCCCCTGAG
GTCAGCGGCCCGGAGGAGCGGAGCGGGTCCGCCGCCGGTGCCACCGCCGACGGCACCGCC
ATGGACGACGCCACCGCCGTCGCCGTCATCGGGCTCTCCGGCCGCTACCCCATGGCCGAC
GACGTCGACGAGTTCTGGGCGAACCTCGCCGCGGGCCGGGACTGCGTCACCGAGATCCCC
GCCGACCGCTGGGACCACGACCGCTACTTCGACGCCGACCCGTCGGCACCCGGTCGCGCC
TCCACCAGATGGGGCGGCTTCCTGCGCGACGTGGACCGCTTCGACCCGCTGTTCTTCGGC
ATCTCGCCGCGCGAGGCGGAGCTGATGGACCCCCAGGAGCGCCTGTTCCTGCAGAACGCC
TGGCATGTGTTCGAGGACGCCGGCTACCGGAGGGACGAGCTCTCGGGCCGCCCGGTCGGG
GTCTTCGTCGGCGTGATGTACGGCGAGTACCAGCTCTACGGAGCCGCGGACGCCGAACGC
GGCGGCATCCGGGTCACCGGTTCGTCGTTCGCCTCCATCGCCAACCGCGTCTCGTACACG
CTCGGCCTGAACGGACCGAGCATCGCGCTCGACACGATGTGCTCCTCGTCGCTGACCGCG
ATCCACCTGGCCTGCGAGAGCCTGCGCACCGGGGAGAGCGAGGCGGCCGTCGCGGGCGGG
GTCAACCTGTCCCTGCACCCGTACAAGTACGTCTTCCTCAGCCAGGGCCGCTTCGTCTCC
GCCGACGGCAGGTGCCGCGCCTTCGGCGCCGGGGGCACCGGCTACGTGCCGGGTGAGGGC
GTCGGCGCGGTACTGCTCAAGCCGCTGGCCGCGGCCGAGCGCGACGGCGACCACATCTAC
GGGGTGATCAGGGGCCACGCCGTCAACCACGGCGGCAGGACCAACGGCTACACCGTGCCG
AGCCCGCACGCGCAGGCCGACGCGGTGCGCCGCGCGCTGCGCGGGGCGGGCCTCGAACCG
GCCGACATCGGATACGTGGAGGCCCACGGCACCGGCACCTCCCTCGGGGACCCGATCGAG
ATCGCCGGGCTCGCCAAGGCCTTCGGCACGCCGAAGGAGGACGGCCCGCGGTGGCCCATC
GGCTCGGTGAAGTCCAACATCGGCCACCTCGAATCGGCCGCGGGCATCGCCGGACTCACC
AAGGTGCTGCTGCAGTTCAGGCACCGGCGCCTCGTCCCCTCGCTGCACGCCGACGAGCCG
AACCCGAACATCGACTTCGGGCGCGCGCCGTTCCGCGTGCAGCGCGAGGCCGCCGACTGG
CCCGAGCCCGCCGGTGCGGACGGTGCCGTGCCCCGCCGCGCCGGACTCAGCTCCTTCGGC
GCGGGCGGTTCCAACGCCCACCTGGTCGTCGAGGAGTACCGTGCGGGCCCCGAGCGCCCC
GAGCGGCCCGTCGCCGGCCAGCGCTTCGCGTGCCCCCTGGTCTTCCCGCTCTCCGCACGG
GACACGGAACGGCTCGGCGTCTACGCGGACCGCCTGGCCGACTTCGCCGAACGCGCGCAC
GTGCGCGCCGAGGACCTCGCCCACACGCTGCAACACGGCCGCGAGGTCATGGAGGAACGC
CTCGCGGTGGTCGCGGAGGACGGCGCCGCCCTCGTCGGGGCGCTCCGTGCCTTCCGTGCG
GGCACGCCGTGCCCCGGGCTCCTGACCGGTGCGTCCGCCGGGTCCGGGCAGCCGGAGGAG
CAGGGGCCGGCCTTCGGTGCCGCCGTGCGGTGGACACGCGAAGGCTCGGCCGACTGGCCC
GGCACCGCCCCGGGCGGCCCGGAGCCGCGCCGCGTTCCCGCGCCGCACTATCCCTTCGCC
CGTGAGCGCTACTGGGTGCCCGCCGCCGACCGGAGCGCGGTCCCCGGCGGGCCCGCGGGC
ATCAGCGGTCCTGCCCGCCTCCATCCGCTGCTCGACGCCAACGAGTCCACCCTCGACGAG
ATCCGCTTCCGCCGCACCTTCCTGGCCGACGAGCCGCTCGTACGTGACCACGTCATCGAG
GGACGTGCCCTGCTCGCCGGCGCGGTCTGCCTGGAGATGGCACGCGCCGCGGCGGGACTC
GCCGGACTCGACGACGCGCTCCGCGTACGGGACGTGCTGTGGGGGCGGCCGGTAGTGATC
GAGGACGGCGGGCCGGCCGACGTGTACGTCGGTCTGACCCGCACGGGCGAGAACCGGGGA
CCCGCGGACGGCGAACTCGCCTTCACCGTCTGGACGTCGCGCGGAGGCGAGCGCACGGTC
CACGTCAGGGGCACGGTGCACGCGGGCCCCGCGGCTCCCGCCGGGGCCGTCGACCTCGAC
GCCCTGCGCGCGAGCTGCCCCGAGGTCAGGGACGGCGCGGCGGTCCGGGCCGCCTACGAC
CGTGCCCGCTTCGCCTACGGACCCGCCTTCGACGTCATCGAGGAGGTCCGCTTCGGCGAG
GGCGGCGCGCTCCTCACCCTCGCGCTGCCCGAGCCGGACGGGGCCACGGCGCTGCCTCCG
GCACTGCTCGACGGCGCGCTGCGCGCGTGCCACTGGGCGGACCGGCCGTCGCCCGAGGAG
AGCGACGGCCTCGCCGTGCCGTTCAACCTCGGCACCCTGGAGATCCGCGCGCCGCGCGGG
ACGCTGCCGCGCAGGTGCTACGCGCACGCCGTGCCCGCCCGGCGCGGCGGTGAGCCGTCC
GGCCTGCGTCGGTTCGACGTCCGCGTACTCGACGAGTCGGGGGCCGAGCTGGTCCGTGTC
GAGGACTTCGGCGGCCGTCACCTCGCGCGGGACGAGGCCCCGTTCTTCTACGAGCAGGTC
TGGCGGGACGAGGACGTCGTGGCGGGCGCCGCTCCCGGCTCCGACGCCGTGCTCGTCCTC
GGGGACGGCGACGAGGTGGCCCGAGGCCTGGCCGGGCGGACCGGCGTGCGGCGCGTCGTC
GACGTACGGGCCGCGGCGGGCTTCGCGCGGACCGGGCCCGACCGCTACGCCGTCGACCCC
GAGTGCCCCGGCGACTTCGAACGGCTCCTCGCGGAGCTGGCACGGGACGGCGTCCGCTCG
CTCGACGTCGTGCACCTGTGGGGCCTGACGGCCGAGCCCGTCGGCTACGGGCGTGAGGGC
GCGTCCGCGCGGGCGGAGGCCGCACTCGACGGTGCCTTCGCGCGCGGGCTGCACTCGCTG
CGCTCCCTCGCCCTCGCCCTGCACGCCGTCCGCCACCCCGGCCGGGTGCGCTGCGCCTAC
GTGCTCGCCGACCCGGAGCGGGGCCCCCGCCCCGACCAGGAGGCCGTGGCGGGTTTCGCG
CTCTCCCTCACCGGGGTCCTGCCGCGCTTCGAACTGTTCACCGTCGCCTGCGCGGACGGC
CTCGACCTACCGGGTCTGCTGGCCGCCGAGCTGACGCAGGGCGGGCGGCCCGCGGGCGCG
GAGATCCGCCACGCGGCGACCGGCCGCCAGGTGCGCGTCCTGCGCAGGGCCGAGGAGACG
CGGACCGCGGCCGCCGTACCCCTGAAGCGGGGCGGCACCTACCTCATCACCGGTGGCACC
GGCGGGATCGGCCTTGAGCTGGCCCGTCATCTGGCGGCCACGTACGCGGCGCGGCTCGTG
CTGATCAGCCGCTCCGCCGGCCGGCCCCCGGCGCGCGAGGCCGCGGACGGGCTCGCGGCG
CTCGGCGCCGAGGTGCTCCTGGTGGCCGCCGACACCGCGGACCCCTCCGGCATGCGGGCC
GCGGTGGCGCGGGCCAAGGAGCGCTTCGGGCACCTCGACGGTGTCTTCCACCTCGCGGGC
GCCGCCGACCAGTGCTCGCTCCTGGACGCGGAGGCCGCCCGCTTCACCGGGCTTCTGTCG
GTGAAGGCCCACGGGGTGCGCCTGCTCGACGCGCTCACGGCCGACGAGCCGCTCGACCTG
TTCGTGGTCTTCTCCTCGATCGCCTCGGTGGTCGGTGACTTCGGTGCCTGCGCCTACGCG
GCGGCCAACCGCTTCCTCGACTCCTACGCGGAAGAGCGCGACCTGCGGGTACGCGAAGGC
CGCGCCTCGGGCCGCACCCTGTCGGCCGCCTGGCCGCTGTGGCGGATCGGCGGCGTGGAC
GCCCTCATGGGCGAGCAGGAACGCACCGGCTACCGCCACCGCACGGGCATGCGCGAGTTC
ACGGGCGAGGAGGGACTGCGGGCCCTTGACCTGGCCTGGCGCACGGGCCTCGTCCGCCTG
GTCCCGGCGGTCGGCGACCCGGACACCGTGGACGCGGCCCTCCTGCCGCGGCCGGCCGCG
GGGGCACGAGCGGACAGCGGAGCCGCGACCGCGGCCACCCGTACGGACGAGACGGCCGTA
CCGGCGTCCGCGGTGCCGCACGCCGCGGGGCCGGTCGCGGTGACGGCGGTGACCCGTACG
AACGGCGCGGCCGTACCGGCGTCCGCCCTCCTGGACCGCATGCGGGACCACGTCCGCGCC
CTGCTCGGCCAGGTGCTCGGTCTCTCGGTGGAGCGCATCGACGATCACACCGCCCTGGAT
GCCTACGGGCTCGACTCCGTGCTGGTGATGGAGACCAATGAACACCTGGACCGGGACTTC
CCCGGCGCCCGCGGCACGCTGCTCTTCGAGTACCGCACCGTGCACGACCTCGCCGCGCAC
CTCCTGGCGGAACATCCCGACGCGGCCCGGCGGCTGTTCCCCGCGGAGACCGCGCCGGTC
GTTCTCCCGGTGAGCGTCGAGGAACGGCCCGCCGCCCCCGCCGCGCCCCCGCGAGCACCC
GCGGACGACGACGACATCGCCGTCATCGGCATCGGTGGCCGGTACCCGCACGCCCGCGAC
CTCACCGAGTTCTGGGAGAACCTGCGCCGAGGCCATGACGCGGTCACCGAGGTGCCCGGG
GACCGCTGGGACGCCGACGCGCACTTCGACGGCGACCACACGGCCCCCGGCTCCAGCTAC
GGCAAGTGGGGCGGCTTCCTGGAGGACGTCGACGCCTTCGACTCCCTCTTCTTCCGCATC
CCGCCCTCCCAGGCCAAACTGATGGACCCGCAGGAACGCCTGTTCCTCGAGGCCGCCTGG
TCCGCGCTGGAGAACGCCGGCTACCCGCCCTCGCGCCTGCCGCGCCCCCGCTTCGGCGGC
CAGGGCCGCGACGTGGGCGTCTTCGCCGGCGTGATGTGGGGCGACTACGCCCAGCTCGCC
GCCGAGGAGTCCGTCAGGGGCAACCACCACACGGTCCTCACCAACCGCTCGGCCATCGCC
AACCAGGTGTCGTACTTCGGTGACTTCCGCGGCCCGAGCGTCGTCGTGGACACCGCCTGC
TCGGCCTCGCTGGTCGCCTTGCACCAGGCCTGCGAGAGCGTCCGCAGGGGCGAGTGCCGC
TATGCCCTCGCGGGCGGTGTCAACGTCTCGGCGCACCCGTCGAAGTACGCGCACCTGAGC
CGGATGCGGATGCTCTCCACCGACGGCCGCTGCCGGTCCTTCGGCGCGGGCGGCGACGGC
TACGTGCCCGGCGAGGGCGTCGGCGCGGTGCTGCTCAAACGGCTCTCGGAGGCCGTCGCC
GACGGCGACCACATCCACGCGGTGATCAAGGCGACGGCGGTCAACCACGGCGGCCGCACC
AGCGGCTACACCGTGCCCAGCCCGCAGGCTCAGCAGGCCCTCATCGAGGAGACCCTCGAC
CGCGCGGGCATCGACCCCCGCACCATCGGCTACGTCGAGGCGCACGGCACCGGCACCGCC
CTCGGCGACCCCATCGAGCACACCGCACTCCAGCAGGCCTTCGCCGGGGTCGTCCGGGAC
GCGGGCGCCATCGCCCTCGGCTCGGTCAAGTCGAACATCGGGCACCTGGAGGGCGCCGCG
GGCATCGCGGGCCTCACCAAGGCCGTGCTCCAGCTCTCCCACGGCCAGTTGGTGCCCTCA
CTGCACTCCGAGGAGACCAACCCGATCATCGACTTCGCCACGTCTCCGTTCCGCGTGCAG
CGTGAACTCGCCGACTGGGCACGGCCCGTCATCGAGACCGACGGAGTGCGGGTGGAGCAG
CCGCGCAGGGCGAGCGTCAGCTCGTTCGGCGCGGGGGGCACCAACGCGCACGTGGTCCTG
GAGGAGTACCGCGCCCCCGAAGGCAGTGCCGCCACCGCGTCGGGCGGCCACGAGCTGCTC
GTGCTCTCCGCGCGCGGCCCCGAGCGGCTGCGCGCCTATGCCGCCGAGATGGCCGCCCAT
CTGCGCCGCGAGCGCCCCGCTCTCGCCGACACCGCCCACACCCTGCGCGTCGGGCGCGAG
GCGCTGCCCGAACGGCTCGCCTTCCCGGCGGCCGACATCGACGACGCCGCCGACAAGTTC
GCCGCCTTCGCCGACGGGGCGTCCGTGCCCTCAGCGATCACCGGGAACGCCGACGGGCAC
ACCGCGCTCGCCGAGGTGTTCACCGACGGCGCGGGCCCCGAGTTCCTGCGGACGCTGGCG
GCCGCCGGGGACGACACCCGCCTCGCCAGGCTCTGGGTCTCCGGGGCCTTCGCCGAGTGG
ACGGCGCTGCACGGGCGCGCGGCGGGCCGGTGCCGGACGGTGCCGCTGCCGGGCTACCCC
TTCGAGCGCCCGCGCCACTGGCTGCCCGTCACCCGTACGGAACTGGCCGACGTGCCCCGG
CCGCCGGGCGAGAAGGAAGCGCGGCCGGAGCCGCCGCGGGCCGCGGACAGGACCCTGACC
CTCGACCCCGCCGATCCGGTCGTACGCGACCACGTCGTCGGCGGCCGTGCGGTGCTGCCC
GGCGTCGGCCACCTGGACCTCGTGGTCCGCGCCCTGGGCGAGGACGCGGCGCGGGTCTTC
CGCGACGTGCGCTGGCTGACGCCGCTCGTGGTGCCGGACACGGGCGCCGAAGTCACCCTC
ACGACCCGGCCCGAAGCCGCCCTCACGACGCGGCCCGAAGCCGTCGGCGCGGCCCGGCCG
GAAGACGGCCCCGCGCTCGGCTACCGCCTGACCGCGTCCTCCGCCGACGCGAGCCCCGTC
CACTCGCTCGGGCAGGTCGTCGCCACCGCGCCCGACCGCCCCGCGCCCCTCTCCGTCGAC
CTGCTCAAGGCGGACTGCCCGCGCCGGGTGAGCCACGAGGAGCTGTACGAGGGCCTGCGC
CGCCGAGGCCTGCCCTACGGACCCCACTTCCGGCGCGTGGCGCAGGCGTGGACCGGCGAC
CGGACCGCCCTGGCCCGGCTGCACCGGCCGGAGGAGTGCTCGGACGCGGCCCGCGGCCCC
CTGGACCCCGGCACACTCGACGCGGCCCTGCACCCGCTGGCCCTGCTCCTCGCCGACGAG
GGAGCGAGCGGCAGGCCGCTGCTGCCGTTCGCCGCGGACCGGGTCGAGATCCACGCGCCG
CTGCCCGACGAAGGCTGGTCCCACGTCCGCGACCTGGGCTCACGGCGGTTCGACGTGACC
GTCACCGACGCCGGGGGCCGGGTCTGCGTACGCGTCACCGGCCTGGCATTGCGGGAGGCG
AAGCCCGAGCCGTCCATCGACTACCGGCCCCGCTGGGCTGTGGCGCCCCCCGCCGTCGCG
GACGCGGTCGCCCCACGGGCGGTCCTGACCGTGACGGGGGAGGAGGGCGCGGCTCTCGCG
GACGCCCTGCGCGAGGCCCACCCGGACGCCGAACACGTACGGCTGAGCATCGGTGAGGGC
GGCCTGGACGAGCGCGCCACCGCCGAACTCCTGGACCGCGTCCCGCACATCGACCTCGTG
TACTTCCTTGACGTGGGCGGCCCGCACGGACCGGCGGCGGACCGGCGCGCGCGGCGCGCG
GCGCAGGACCGCGGCACCGTCGCGCTGTACCGGCTGGTCCGCGGCCTCGACCGGGCCGGA
CTGCTGGACGGTCCCCTGGCCCTCAAGGTGCTCACCACCGACGCCCTGCCGCTCGGCGAC
GACGACGCGGTGCGCCCCGAGGCCGCCGGACCCATCGGCTTCTGCGAGGTCGCGGCCAAG
GAGTTCCCGCGGCTCAGCGCGGCCTGCCTCGATGTGCGGAGGGAAGAGCTCGGCGACGGC
GTGCGCGCGCTGGTGCGCGAGCCGGTGCGGGCGAAGGTCCGTCCGGTGTCGCTGCGCGGC
GGGGTGCGACGGATCCGCAGGCTCGAAGCGGTGGCACCGGCCGCCGCCCCGACCCGCTTC
CGCGAGCGCGGGGTGTACCTCGTCATCGGCGGCCTCGGGGTGCTCGGACGTGACACCGCC
CGGTATCTGGCCCGCACCTACCGCGCCCGCCTGGTGCTGGTGGGCCGGGGCGCGGTGGAC
GAGCGGCGCCGCGCCGACCTCGCGGCGATCGAGGAGCTGGGAGCGGAGGTGTCCTACGTT
CCGTGCGACGCCGGTGACCCGGTGGCCCTGCGCCAGGTGATCGACGAGACCAAGGACCGC
TTCGGCGCGCTCCACGGCGTGATCCACTCCGCGATGGTGCTCGTCGACAAGCCCATCAGG
CGGCTCGCCGAGGCCGAGCTGCGCACCGCCCTCGACGCCAAGGCGGACACGGTGTGGAGC
ATGTTCCGGGCCCTGCGCGGCGAGCGGCCGGACTTCGTGCTGCTGTACTCCTCCGCGGTC
ACCTTTGAGGGCAACCACGGCCAGGCCGGATACGCGGCGGGCTGCCATGTCGCCGACGCG
TGGGCGCTCGCCGGGGCCCGCACCGCGCCCTACCCCGTCCGCACCGTCAACTGGGGCTAC
TGGCACGCCGCGGGCGACACGCACCGGGAGAGCGTCCTGAGCCGCTTCGCCGCCGCGGGC
ATCCGGCCCATCGGCGCGGAGGAGGGCATGGCGGCCGTGGAGCGGGTGCTCTCCGGCACG
CTCCCGCAGGCGCTCGTCGTCAAGGCGGACCAGAGGATCCTCGCCGGTCTCGGCGTCGAC
ACGGACACCGTGCTGCGGGCGCAGCCTGAGCTGCCCGCGTCCTCGGCGCCGCTCGCGCCG
GGCCCCGGGTCGACGGAGCCGTACACCCGGAGCGGCGGCGCGGCCGCGGAGACCGAGACG
TTCGCCCGGCGGCTGCTCGTCGGCGCCCTGCGGAGCATGGGCGTCCTGCGGGGGCCCGGC
GAGCGGTACACCCGCGACGGGCTCCGCGCCCGCCTCGGCGTCGTCGAGGCACAGGAGCGG
CTCCTCGGCCTCCTCGTCGACGTCCTGCTGCGCGGCGGTCATCTCCGCGCGGAAGGCCCC
GAGCTGGTGACCACCGACCTGGTCGTCGACCCGGAAGTGCTCCGCTGCGTCGAACGCCCC
GAGGAGGCGGCGGCCGGCCTGACGGCACGCCACCCCGACGCGGGCGCGGTGACGGCCCTG
CTGCTGCGCTGCGTCGAAGCCCTGCCCGAGGTGCTGACCGGCCGGCGCGGCCACCTGGAC
GTGCTCTTCCCCGGCGGCTCCTTCGACCTGGTGGAGGCCGTCTACGCGGGCGACCCCGTC
ACCGACCGGTGCAACGAACAGGTCGCCGGCGCGGTGCTGCGGTACGTGACGGAGCGCCTG
CGGAGCCGTCCCGGTGACCGTGTCAGGGTGCTCGAAGTCGGCGCGGGCACCGGCGGCACC
AGCGCCCGTGTCCTGCGCGCGCTCGCCACGGCCGGTCTCGGCGACCACGTCGAGTACCTG
TACACCGACGTGTCCGAAGGATTCGTGCGGCACGGCCGCAAGCGCTTCGGCGCCGGCCAT
CCGTTCGCGGACTTCCGGGCGCTCGACATCGAACGCGTCCCCGAGGAGCAGGGCTTCGAG
AGCGGCGGGTACGACCTGGTGCTCGGCTCCAACGTGTTCCACGCGACAGGGCGCATCGAC
CGCACCCTGGCCCACACCAAGCGGCTCCTCGGCACGAACGGCGTACTGGTGCTGAACGAG
GGCGTCGAACTCCGCGACCAGATGTCCCTGATCTTCGGCCTCGCCACTGGCTGGTGGCTG
TTCGAGGACGCGGAGTACCGGCTGCCCCACTCCCCGCTCCTGTCCACGACCGCCTGGCGC
GACGTCCTCGCCCACAACGGCTTCCGCGGGGTCACCGAGGCGCCGCGCCCGGACGGCGGC
ACCCACCAGTGCGTCCTGGTGGCCGAGAGCGACGGCTTCGTGCCCGTGACGGCGGCCGCG
CCCGGCCCGCCCGTCCCGGCCGCGTCGTCCGCCCCCGCGGCGGTGAGCACCGTGCCCGCG
GGGCCCGACCCCGTCCGCGACGCGGAGCGCCGGGTCAAGGCGGTCTTCGCGCGCGTGCTG
GAGATGGAGGAGGACCTCCTCGACGCCCGGGCCACCTTCGAGAACTACGGCGTCGACTCA
CTCGTGGTCCTCAGCCTCACCAAGGAGCTTGAACAGGAGTACGGGCCGCTGCCCTCGACC
CTGCTCTTCGAGCACATCACCATCGAACGCCTCGCCCGCCACCTCGCGGCGACCGGTGCC
GCAGGGACGGCGGCGGGGACTGCGGCCGGGCCCGCGCGCGCGGCGGAACCGGAGGCCGGG
ATCGAGCAGCTCGTCGACAGCCTCTCCGACACCGAGGTGGACAGCCTGCTGCGCCAGTTG
GGCAGCGTTCTCCAGAAGCAGGAGGAGCAGCGATGA
[2] KS18..394
[2] DH612..781
[2] KR1129..1314
[2] ACP1400..1468
[3] KS1526..1897
[3] DH2128..2293
[3] KR2652..2836
[3] ACP2954..3022
[4] KS3064..3443
[4] DH3687..3853
[4] KR4184..4364
[4] MT4631..4736
[4] ACP4848..4916
[2] KS52..1182
[2] DH1834..2343
[2] KR3385..3942
[2] ACP4198..4404
[3] KS4576..5691
[3] DH6382..6879
[3] KR7954..8508
[3] ACP8860..9066
[4] KS9190..10329
[4] DH11059..11559
[4] KR12550..13092
[4] MT13891..14208
[4] ACP14542..14748

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR009081 Acyl carrier protein-like (Domain)
 [1404-1466]  3.1e-11 PF00550 [2958-3021]  5.5e-08 PF00550 [4851-4915]  1.5e-11 PF00550
PF00550   PP-binding
 [1404-1472]  6.00000000000001e-44 G3DSA:1.10.1200.10 [2952-3071]  6.40000000000004e-44 G3DSA:1.10.1200.10 [4847-4917]  6.00000000000001e-44 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [1397-1541]  6.20000124972815e-16 SSF47336 [2947-3080]  3.00000067992871e-18 SSF47336 [4841-4937]  5.20000089003336e-16 SSF47336
SSF47336   ACP_like
 [1400-1468]  PS50075 [2954-3022]  PS50075 [4848-4916]  PS50075
PS50075   ACP_DOMAIN
IPR013217 Methyltransferase type 12 (Domain)
 [4631-4736]  2.2e-13 PF08242
PF08242   Methyltransf_12
IPR013968 Polyketide synthase, KR (Domain)
 [1129-1312]  1.29999999999998e-57 PF08659 [2652-2835]  3.09999999999998e-51 PF08659 [4184-4362]  4.5e-45 PF08659
PF08659   KR
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [18-268]  8.80000000000003e-68 PF00109 [1526-1772]  3.99999999999998e-89 PF00109 [3064-3318]  3.99999999999998e-90 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [276-394]  1.29999999999998e-36 PF02801 [1780-1897]  2.50000000000001e-41 PF02801 [3326-3443]  1.29999999999998e-38 PF02801
PF02801   Ketoacyl-synt_C
IPR016038 Thiolase-like, subgroup (Domain)
 [18-279]  G3DSA:3.40.47.10 [280-447]  G3DSA:3.40.47.10 [1526-1783]  G3DSA:3.40.47.10 [1784-1954]  G3DSA:3.40.47.10 [3072-3329]  G3DSA:3.40.47.10 [3332-3504]  G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [10-446]  8.39998014024973e-76 SSF53901 [1517-1955]  8.89993011983204e-98 SSF53901 [3056-3505]  2.7000136937899e-92 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [1129-1316]  2.09999999999996e-108 G3DSA:3.40.50.720 [2650-2863]  2.09999999999996e-108 G3DSA:3.40.50.720 [4183-4378]  8.1e-98 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [181-197]  PS00606 [3231-3247]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [1401-1471]  6.20000124972815e-14 SM00823 [2955-3025]  5.99999702863249e-08 SM00823 [4849-4919]  2.90000354677981e-17 SM00823
SM00823   PKS_PP
IPR020807 Polyketide synthase, dehydratase domain (Domain)
 [612-781]  6.79998707392904e-29 SM00826 [2128-2293]  4.19999771339581e-24 SM00826 [3687-3853]  8.80000265836278e-09 SM00826
SM00826   PKS_DH
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [20-446]  SM00825 [1527-1955]  SM00825 [3066-3505]  SM00825
SM00825   PKS_KS
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [1129-1314]  4.60000044330862e-47 SM00822 [2652-2836]  2.19999900980707e-41 SM00822 [4184-4364]  1.10000150671643e-33 SM00822
SM00822   PKS_KR
SignalP No significant hit
TMHMM No significant hit