close all open/close all

CDS information : Oxzol_00200


close this sectionLocation

Organism
StrainJA3453
Entry nameOxazolomycin
Contig
Start / Stop / Direction80,335 / 83,925 / + [in whole cluster]
80,335 / 83,925 / + [in contig]
Location80335..83925 [in whole cluster]
80335..83925 [in contig]
TypeCDS
Length3,591 bp (1,196 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.2 NRPS
Productnon-ribosomal peptide synthetase
Product (GenBank)NRPS
Gene
Gene (GenBank)ozmO
EC number
Keyword
  • glycine
Note
Note (GenBank)
Reference
ACC
PmId
[20406823] Oxazolomycin biosynthesis in Streptomyces albus JA3453 featuring an "acyltransferase-less" type I polyketide synthase that incorporates two distinct extender units. (J Biol Chem. , 2010)

close this sectionPKS/NRPS Module

0 glycine
F64..280
A603..1001
PCP1089..1156

close this sectionSequence

selected fasta
>non-ribosomal peptide synthetase [NRPS]
MTTPFSAVLIGEQPLLAECGEHLLTRGHQVAAVVARDPGLRRWAAGHGLRVVEPGRGLAE
RLRPLRFAYLFSVTNLRMLPDDVLALPERMPVNFHDALLPRHAGLHATSWAVLEGAAEHG
VTWHVMEREADTGDVLKQRAVPVGPDDTAYTLNLACYEAAAATFGELVDELASGTETRTP
QDLALRTYHGLHDGPPDGGLFSWRRPAADLVALVRATDLGPHRNAFGLALLALDERLFAV
RKAEVTDDPSTSPPGTVVAVEGPAVVVATTDLDVRLTELSDLDGAGREPRPGDRFTELDD
AARQRWAAAARAARRHEGYWLRLLADRAPLEVPWPAAVEPAEPSGARTLARAEVPEDIPA
EDPGSPRAWLLAALLLFLGRMAGEGAGGFDVGLRRAGAVSGPVVSGPAVSGPVVSGPVVS
DVPFRAPEAAEGLPLAALAEAVAERLAELGERSAPLRGAHLRMAGPAGRAALAGTALPVT
VDLGDGRGTTHRPDGPALTVRLGGPADTPRSVAFVPADPAKEAAAHRLAARFERFLRTAA
ERPDEEAALLPLLSDEERRQVLDTWNDTATPYPADRCVHQLFAEWSTRQPDAPAVRCGDT
VLTYGELDRRSGLLARRLARLGAGPGTLVGVFLDRSADLLTALLAVARTGAAYVPLDPVY
PPERIRHMLDDSGAILVLTEPALAAALPEDCPARTVELGPGAEDADDGPLDQDRDGFPDR
ASAADLAYVIYTSGSTGLPKGVRIGHRALTNFLCAMAREPGFGRDDRLLAVTTACFDIAG
LELYLPLVTGGEVRVAPADTVADGFALRELVEAYRPTVMQATPVTWRMLIDAGWRGGPGL
TVLCGGEALPADLAADLVRRADRVMNMYGPTETTIWSSVDRVEAGRPVTIGRPLANTRMY
VLDERLRPVPPGSPGELYIGGDGVAEGYHRRPELTAARFLDDPFGPGRIYRTGDLVRHLP
DGRLAYLRRTDNQVKLHGYRIESGEVETVLRDHPAVAQAAVVVRADEPGGGRLVAYAVAE
GTARLPDTAELREHVRARLPAYMVPSAVVALPALPLTPNGKLDRKALPAPHAVAASAGRP
GEAVPRDALERRISAIWQSALGPEQVGVDVNFFDAGGDSLRLTHVVARLRAELRPSLSRL
DMFRHPTIRTMARHLAGDGDGDGDGAAHRPPVRGRQQGGRDRSLLGARRRRSGAER
selected fasta
>non-ribosomal peptide synthetase [NRPS]
ATGACCACGCCCTTCAGCGCCGTCCTGATCGGCGAGCAGCCCCTCCTCGCCGAGTGCGGC
GAGCATCTGCTGACCCGGGGCCACCAGGTGGCCGCCGTGGTGGCGAGGGACCCGGGGCTG
CGCCGCTGGGCCGCCGGGCACGGACTGCGGGTGGTCGAGCCGGGCCGGGGCCTCGCGGAG
CGGCTGCGCCCGCTGCGGTTCGCGTACCTGTTCAGCGTCACCAATCTGCGGATGCTGCCC
GACGACGTCCTCGCGCTGCCCGAGCGGATGCCCGTCAACTTCCACGACGCGCTGCTGCCC
CGGCACGCCGGTCTGCACGCCACGAGCTGGGCCGTCCTGGAGGGCGCCGCCGAGCACGGC
GTCACCTGGCACGTCATGGAGCGCGAGGCCGACACGGGCGACGTGCTCAAGCAGCGGGCG
GTGCCGGTCGGACCCGACGACACCGCGTACACCCTCAACCTCGCCTGCTACGAGGCCGCG
GCCGCCACCTTCGGTGAACTCGTCGACGAACTCGCCTCGGGCACCGAGACCCGCACCCCG
CAGGACCTGGCCCTGCGCACCTACCACGGGCTCCACGACGGCCCGCCCGACGGAGGCCTG
TTCTCCTGGCGCAGGCCCGCGGCCGACCTCGTCGCCCTGGTGCGCGCCACCGACCTCGGA
CCGCACCGCAACGCGTTCGGCCTCGCGCTGCTCGCCCTGGACGAGCGCCTCTTCGCCGTA
CGGAAGGCGGAGGTCACCGACGACCCGTCGACGAGCCCGCCCGGCACCGTGGTCGCCGTC
GAAGGGCCGGCGGTCGTCGTCGCCACCACTGACCTCGACGTGCGTCTGACGGAGCTGTCC
GACCTGGACGGCGCGGGCCGTGAACCGCGCCCCGGGGACCGGTTCACGGAGCTGGACGAC
GCCGCCCGGCAGCGGTGGGCGGCAGCCGCCCGCGCCGCGCGGCGGCACGAGGGGTACTGG
CTGCGCCTGCTCGCCGACCGGGCGCCCCTCGAAGTCCCCTGGCCCGCGGCCGTGGAGCCC
GCGGAGCCGTCCGGGGCCCGCACCCTCGCCCGCGCCGAGGTGCCGGAGGACATCCCGGCC
GAGGACCCGGGGAGCCCCAGGGCCTGGCTGCTCGCCGCACTGCTGCTGTTCCTCGGCCGG
ATGGCGGGGGAGGGCGCCGGAGGCTTCGACGTGGGGCTCCGCCGCGCCGGGGCGGTATCC
GGGCCTGTGGTGTCCGGGCCTGCGGTGTCCGGGCCTGTGGTGTCCGGGCCTGTGGTGTCC
GACGTGCCCTTCCGTGCTCCCGAGGCCGCCGAGGGCCTTCCCCTGGCCGCGCTCGCCGAA
GCGGTGGCCGAGCGGCTCGCCGAGCTGGGGGAGCGGAGCGCCCCGCTGCGGGGCGCGCAC
CTGCGCATGGCGGGGCCCGCCGGGCGAGCGGCACTCGCGGGCACCGCGCTGCCGGTCACC
GTGGACCTGGGCGACGGCCGCGGCACCACGCACCGCCCGGACGGGCCCGCCCTGACCGTA
CGGCTCGGTGGTCCGGCGGACACACCCCGCAGCGTCGCCTTCGTCCCGGCGGACCCGGCC
AAGGAGGCCGCCGCACACCGACTGGCGGCCCGCTTCGAGCGGTTCCTGCGCACGGCGGCC
GAACGGCCCGACGAGGAGGCCGCACTGCTCCCGCTGCTCTCCGACGAAGAGCGCCGCCAG
GTCCTGGACACCTGGAACGACACGGCCACCCCCTACCCCGCCGACCGGTGCGTGCACCAG
CTCTTCGCCGAGTGGAGCACCCGGCAGCCGGACGCGCCCGCGGTCCGCTGCGGCGACACC
GTCCTCACCTACGGCGAACTCGACCGCAGGTCCGGCCTGCTCGCCCGCCGCCTCGCCCGC
CTCGGCGCGGGCCCCGGCACGCTCGTCGGCGTCTTCCTCGACCGCTCGGCGGACCTGCTC
ACGGCCCTGCTCGCGGTGGCCAGGACGGGCGCCGCCTACGTACCGCTCGACCCGGTCTAC
CCGCCCGAGCGCATCCGGCACATGCTCGACGACTCCGGGGCCATCCTGGTGCTCACCGAG
CCCGCGCTCGCCGCCGCGCTGCCGGAGGACTGTCCGGCGCGCACGGTGGAACTCGGCCCC
GGAGCCGAGGACGCCGACGACGGGCCCCTCGACCAGGACCGTGACGGCTTCCCCGACCGG
GCCTCGGCCGCGGACCTCGCCTACGTCATCTACACCTCCGGCTCCACCGGCCTGCCCAAG
GGCGTACGGATCGGCCACCGCGCGCTGACCAACTTCCTCTGCGCCATGGCACGCGAGCCG
GGCTTCGGCCGCGACGACCGCCTCCTCGCGGTCACCACGGCCTGCTTCGACATCGCCGGT
CTTGAGCTGTACCTGCCACTGGTCACGGGCGGCGAGGTCCGGGTGGCGCCGGCCGACACC
GTCGCCGACGGCTTCGCGCTGCGCGAACTCGTCGAGGCCTACCGGCCGACCGTCATGCAG
GCGACGCCCGTCACCTGGCGCATGCTGATCGACGCGGGCTGGCGAGGCGGACCCGGTCTT
ACCGTGCTGTGCGGGGGCGAGGCGCTGCCCGCCGACCTGGCCGCCGACCTGGTCCGGCGG
GCGGACCGGGTCATGAACATGTACGGGCCGACCGAGACCACCATCTGGTCCTCCGTCGAC
AGGGTCGAGGCGGGACGGCCGGTCACCATCGGCCGTCCGCTGGCCAACACGCGGATGTAC
GTGCTCGACGAACGGCTGCGGCCCGTGCCGCCGGGCAGTCCGGGGGAGCTGTACATCGGC
GGTGACGGGGTCGCCGAGGGCTACCACCGGCGCCCCGAGCTCACCGCGGCCAGGTTCCTG
GACGACCCGTTCGGGCCCGGCCGGATCTACCGCACGGGTGACCTGGTGCGGCATCTGCCC
GACGGCCGCCTCGCCTACCTGCGCCGGACGGACAACCAGGTCAAGCTGCACGGCTACCGC
ATCGAGTCGGGCGAGGTGGAGACCGTCCTGCGCGACCACCCCGCCGTGGCTCAGGCGGCG
GTGGTGGTGCGTGCGGACGAGCCCGGCGGCGGCCGTCTCGTCGCCTACGCCGTGGCCGAG
GGGACGGCGCGGCTCCCGGACACCGCCGAACTGCGCGAGCACGTGCGGGCGCGGCTGCCC
GCCTACATGGTCCCGTCGGCCGTCGTCGCGCTGCCCGCGCTGCCGCTGACGCCGAACGGC
AAGCTCGACCGCAAGGCCCTGCCCGCCCCGCACGCCGTGGCGGCCTCCGCGGGGCGGCCG
GGGGAAGCCGTGCCGCGCGACGCGCTGGAGCGGCGGATCTCCGCGATCTGGCAGAGCGCG
CTCGGCCCGGAACAGGTCGGCGTCGACGTCAACTTCTTCGACGCGGGCGGCGACTCCCTG
CGGCTGACCCACGTGGTGGCCCGGCTCAGGGCGGAGCTGCGCCCCTCGCTGAGCCGGCTG
GACATGTTCCGTCACCCGACGATCCGGACGATGGCCCGCCATCTCGCCGGGGACGGGGAC
GGGGACGGGGACGGGGCCGCGCACCGGCCGCCGGTGCGCGGGCGGCAGCAGGGCGGCCGG
GACAGGTCGCTGCTCGGGGCGCGCCGCCGGAGGTCCGGCGCCGAACGCTGA
[0] F64..280
[0] A603..1001
[0] glycine777..876
[0] PCP1089..1156
[0] F190..840
[0] A1807..3003
[0] glycine2329..2628
[0] PCP3265..3468

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000873 AMP-dependent synthetase/ligase (Domain)
 [603-1001]  1.5e-111 PF00501
PF00501   AMP-binding
IPR002376 Formyl transferase, N-terminal (Domain)
 [6-189]  1.80000000000002e-35 G3DSA:3.40.50.170
G3DSA:3.40.50.170   Formyl_transf_N
 [5-194]  2.99998750445706e-43 SSF53328
SSF53328   formyl_transf
 [64-160]  8.1e-20 PF00551
PF00551   Formyl_trans_N
IPR005793 Formyl transferase, C-terminal (Domain)
 [200-280]  1.4e-08 G3DSA:3.10.25.10
G3DSA:3.10.25.10   Formyl_trans_C
 [198-280]  2.7e-06 PF02911
PF02911   Formyl_trans_C
IPR006162 Phosphopantetheine attachment site (PTM)
 [1114-1129]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [1082-1157]  2.70000183580794e-18 SSF47336
SSF47336   ACP_like
 [1083-1158]  1.5e-22 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [1089-1156]  PS50075
PS50075   ACP_DOMAIN
 [1092-1155]  4.9e-14 PF00550
PF00550   PP-binding
IPR010071 Amino acid adenylation domain (Domain)
 [603-1001]  7.30000000000007e-124 TIGR01733
TIGR01733   AA-adenyl-dom
IPR011034 Formyl transferase, C-terminal-like (Domain)
 [197-295]  2.59999946718995e-08 SSF50486
SSF50486   FMT_C_like
IPR020845 AMP-binding, conserved site (Conserved_site)
 [729-740]  PS00455
PS00455   AMP_BINDING
SignalP No significant hit
TMHMM No significant hit