close all open/close all

CDS information : Oxzol_00210


close this sectionLocation

Organism
StrainJA3453
Entry nameOxazolomycin
Contig
Start / Stop / Direction83,971 / 85,119 / + [in whole cluster]
83,971 / 85,119 / + [in contig]
Location83971..85119 [in whole cluster]
83971..85119 [in contig]
TypeCDS
Length1,149 bp (382 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)OzmP
Gene
Gene (GenBank)ozmP
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[20406823] Oxazolomycin biosynthesis in Streptomyces albus JA3453 featuring an "acyltransferase-less" type I polyketide synthase that incorporates two distinct extender units. (J Biol Chem. , 2010)

close this sectionSequence

selected fasta
>hypothetical protein [OzmP]
MEPTIVRCKICSLKEGHPGIVLDDQRVCSLCNLDFAGDLLVNYKYTNEVFAEFQAAPPDP
RGEFDCLFMYSGGKDSTYMLDKFVNEYGKRTLAYTFDVPFESTHAAQNIKLAQEKLPATF
VVDADDDNIKKMMRDVFNRPRPKKPGQYLDEKLPCVSCRTFFVIRAILHAYREHIPYIAL
CADPQQILTMESNVREVVRGFYKSFGPELASELFDGEIEEILFAEDDELPKIVFPFIAMR
HDYDPDRMVAELKEKGLYASSPMETHCTLFPLLNYYSFKNWDCMFYKLNASSYTRAVSRN
KDYDRSTFSIKFPRSLDLPEVEEKLKRVVLEIAAGEGDREQHRAALVELFKQMDTTDDGA
AFIAETFLDMRAVAADLGIKVG
selected fasta
>hypothetical protein [OzmP]
GTGGAACCCACCATCGTCCGCTGCAAGATCTGCTCGCTCAAGGAAGGGCACCCGGGAATC
GTCCTCGACGACCAGCGGGTGTGCAGCCTCTGCAACCTCGATTTCGCGGGCGACCTGCTC
GTCAACTACAAGTACACCAACGAGGTGTTCGCCGAGTTCCAGGCGGCACCGCCCGACCCG
CGCGGCGAGTTCGACTGCCTCTTCATGTACAGCGGCGGCAAGGACAGCACGTACATGCTG
GACAAGTTCGTCAACGAATACGGCAAGCGGACCCTCGCCTACACCTTCGACGTGCCCTTC
GAGAGCACGCACGCCGCGCAGAACATCAAGCTGGCGCAGGAGAAGCTGCCCGCGACGTTC
GTGGTGGACGCGGACGACGACAACATCAAGAAGATGATGCGGGACGTCTTCAACCGGCCG
CGCCCGAAGAAGCCGGGCCAGTACCTCGACGAGAAGCTGCCCTGTGTCTCCTGCCGCACG
TTCTTCGTGATCCGGGCCATTCTGCACGCCTACCGCGAGCACATCCCGTACATCGCCCTC
TGCGCCGACCCGCAGCAGATCCTCACGATGGAGTCGAACGTCAGGGAAGTGGTGCGCGGC
TTCTACAAGTCCTTCGGGCCCGAACTCGCGAGCGAGCTGTTCGACGGCGAGATCGAGGAG
ATCCTCTTCGCCGAGGACGACGAACTCCCCAAGATCGTCTTTCCGTTCATCGCGATGCGG
CACGACTACGACCCCGACCGCATGGTGGCGGAGCTGAAGGAGAAGGGCCTCTACGCCTCT
TCGCCGATGGAGACGCACTGCACGCTGTTCCCCCTCCTGAACTACTACTCGTTCAAGAAC
TGGGACTGCATGTTCTACAAGCTCAACGCGTCCAGCTACACGCGCGCGGTGAGCCGCAAC
AAGGACTACGACCGCTCCACCTTCAGCATCAAGTTCCCGCGCTCCCTGGATCTGCCCGAG
GTCGAGGAGAAGCTGAAGCGGGTGGTCCTGGAGATAGCCGCCGGTGAGGGGGACCGCGAG
CAGCACCGCGCGGCGCTGGTCGAGCTGTTCAAGCAGATGGACACCACCGACGACGGCGCC
GCCTTCATCGCGGAGACGTTCCTGGACATGCGGGCGGTCGCGGCCGATCTCGGTATCAAG
GTGGGTTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR014729 Rossmann-like alpha/beta/alpha sandwich fold (Domain)
 [67-180]  2e-10 G3DSA:3.40.50.620
G3DSA:3.40.50.620   Rossmann-like_a/b/a_fold
SignalP No significant hit
TMHMM No significant hit