close all open/close all

CDS information : Oxzol_00230


close this sectionLocation

Organism
StrainJA3453
Entry nameOxazolomycin
Contig
Start / Stop / Direction89,302 / 88,376 / - [in whole cluster]
89,302 / 88,376 / - [in contig]
Locationcomplement(88376..89302) [in whole cluster]
complement(88376..89302) [in contig]
TypeCDS
Length927 bp (308 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Productputative LysR family transcriptional regulator
Product (GenBank)transcriptional regulator
Gene
Gene (GenBank)ozmR
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[20406823] Oxazolomycin biosynthesis in Streptomyces albus JA3453 featuring an "acyltransferase-less" type I polyketide synthase that incorporates two distinct extender units. (J Biol Chem. , 2010)
Related Reference
ACC
P94632
PmId
[8971704] A new type of transporter with a new type of cellular function: L-lysine export from Corynebacterium glutamicum. (Mol Microbiol. , 1996)
[11429454] Expression control and specificity of the basic amino acid exporter LysE of Corynebacterium glutamicum. (Microbiology. , 2001)

close this sectionSequence

selected fasta
>putative LysR family transcriptional regulator [transcriptional regulator]
MMSLHGNLSELPLEQVRTLLAVVDEGTFEAAAAVLHVTPPAVSQRVKALERRTGRVLVMR
TKPVRPTESGQVVVRFARQLARLERDARAELGIGDSGRGALLPVAVNADSLATWFLTALT
RVPDELRICFELRREDEEHTTSLLREGAVMAAVTSSPDAVSGCTVRRLGRMRYLPVAAPE
FVERWLGGRPRVPLGQVVADAPVLLFDRRDCLQDQFAREVTGGRGAGALRHYVPSSRGFA
EAIEAGLGWGVVPRAQAEPLLRAGRLTLLDPERMVDVPLFWQQWKLDSPALAALAEAVVS
TAAEALDQ
selected fasta
>putative LysR family transcriptional regulator [transcriptional regulator]
GTGATGTCCCTGCACGGCAATCTCTCGGAGCTGCCCCTCGAACAGGTGCGGACGCTGCTC
GCCGTCGTCGACGAGGGCACGTTCGAGGCGGCGGCGGCCGTCCTGCACGTCACGCCGCCG
GCCGTCAGCCAGCGCGTCAAGGCGCTGGAGCGCAGGACGGGCCGGGTCCTGGTGATGCGG
ACAAAGCCGGTGCGGCCCACGGAGTCGGGACAGGTCGTCGTGCGGTTCGCGCGGCAGCTC
GCGCGCCTCGAACGGGACGCGCGGGCCGAGCTCGGCATCGGCGACTCGGGCCGGGGCGCC
CTGCTGCCGGTGGCGGTGAACGCCGACTCGCTCGCGACCTGGTTCCTGACCGCGCTCACC
CGGGTCCCTGACGAGCTGCGGATCTGCTTCGAGCTGCGCCGCGAGGACGAGGAGCACACG
ACGTCGCTGCTGCGGGAGGGCGCGGTGATGGCCGCGGTGACCTCGTCGCCGGACGCCGTC
TCGGGCTGCACGGTGCGCCGCCTCGGGCGGATGCGCTATCTGCCGGTGGCCGCGCCGGAG
TTCGTCGAGCGGTGGCTCGGCGGCCGGCCCCGGGTGCCGCTGGGGCAGGTCGTCGCGGAC
GCGCCCGTTCTGCTCTTCGACCGCCGCGACTGTCTCCAGGACCAGTTCGCGCGCGAGGTC
ACCGGTGGCCGGGGGGCGGGCGCCCTGCGGCACTACGTCCCCTCGTCGCGGGGCTTCGCC
GAGGCGATCGAGGCGGGCCTCGGCTGGGGCGTGGTGCCACGCGCGCAGGCGGAGCCGCTG
CTGCGGGCCGGGCGGCTGACGCTGCTCGACCCCGAGCGGATGGTGGACGTACCGCTGTTC
TGGCAGCAGTGGAAGCTCGACTCGCCCGCGCTCGCGGCGCTGGCGGAGGCCGTGGTGAGT
ACGGCGGCGGAGGCGCTGGACCAGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000847 Transcription regulator HTH, LysR (Domain)
 [13-71]  5.40000000000002e-18 PF00126
PF00126   HTH_1
 [11-67]  PS50931
PS50931   HTH_LYSR
IPR005119 LysR, substrate-binding (Domain)
 [127-300]  4.80000000000001e-14 PF03466
PF03466   LysR_substrate
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [13-91]  2.6e-19 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
IPR017685 Transcription regulator ArgP (Family)
 [14-305]  1.20000000000001e-102 TIGR03298
TIGR03298   ArgP
SignalP No significant hit
TMHMM No significant hit