close all open/close all

CDS information : Oxzol_00240


close this sectionLocation

Organism
StrainJA3453
Entry nameOxazolomycin
Contig
Start / Stop / Direction89,340 / 89,984 / + [in whole cluster]
89,340 / 89,984 / + [in contig]
Location89340..89984 [in whole cluster]
89340..89984 [in contig]
TypeCDS
Length645 bp (214 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.3 transport
Productputative transporter
Product (GenBank)membrane protein
Gene
Gene (GenBank)ozmS
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[20406823] Oxazolomycin biosynthesis in Streptomyces albus JA3453 featuring an "acyltransferase-less" type I polyketide synthase that incorporates two distinct extender units. (J Biol Chem. , 2010)
Related Reference
ACC
P94633
PmId
[8971704] A new type of transporter with a new type of cellular function: L-lysine export from Corynebacterium glutamicum. (Mol Microbiol. , 1996)
Family/Domain
FD
IPR001123

close this sectionSequence

selected fasta
>putative transporter [membrane protein]
MRAVIHTVDAMGSTLTAAAAGFGTGLSLIVAIGAQNAFVLRQGVRRQAVLTVVAVCAVSD
AVLIAAGVAGVGAAVTAWPPALTLVGLTGGAFLLSYAVLAARRALRPGAMSAAGATAGSR
RGALLACLAMTWLNPHVYLDTVLLLGSVAAGHGGLRWAFGLGAMLGSVVWFTALGYGARL
LSGFFARPAAWRLLDALIAVMMAAMGLTLVIGAL
selected fasta
>putative transporter [membrane protein]
ATGCGTGCGGTGATCCATACCGTCGACGCCATGGGATCAACACTGACCGCCGCGGCCGCC
GGCTTCGGCACCGGACTCTCGCTCATCGTCGCCATCGGCGCGCAGAACGCCTTCGTCCTG
CGCCAGGGCGTCCGCCGGCAGGCCGTGCTCACCGTAGTGGCCGTCTGCGCCGTGTCCGAC
GCCGTCCTCATCGCCGCGGGTGTCGCCGGGGTCGGCGCGGCGGTGACCGCCTGGCCGCCG
GCGCTCACCCTCGTCGGCCTGACGGGCGGCGCCTTCCTCCTCTCGTACGCCGTGCTCGCC
GCACGCCGCGCCCTGCGGCCCGGGGCGATGTCGGCCGCGGGCGCCACGGCGGGCAGCCGG
CGCGGCGCCCTGCTCGCCTGCCTCGCCATGACCTGGCTGAACCCGCACGTCTACCTCGAC
ACCGTCCTGCTCCTCGGCTCGGTCGCCGCGGGCCACGGCGGGCTGCGGTGGGCCTTCGGG
CTCGGCGCGATGCTCGGCAGCGTCGTCTGGTTCACCGCGCTCGGCTACGGAGCCCGCCTG
CTCAGCGGCTTCTTCGCGCGCCCGGCCGCCTGGCGGCTCCTCGACGCCCTGATCGCCGTC
ATGATGGCGGCCATGGGCCTCACCCTGGTCATCGGCGCGCTCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001123 Lysine-type exporter protein (LYSE/YGGA) (Family)
 [26-211]  5.49999999999995e-40 PF01810
PF01810   LysE
SignalP
 [1-34]  0.935 Signal
Bacteria, Gram-positive   
 [1-34]  0.576 Signal
Eukaryota   
TMHMM
 [10-32]  Transmembrane (o-i) [52-74]  Transmembrane (i-o) [79-101]  Transmembrane (o-i) [122-144]  Transmembrane (i-o) [154-176]  Transmembrane (o-i) [189-211]  Transmembrane (i-o)
Transmembrane 6