close all open/close all

CDS information : Oxzol_00250


close this sectionLocation

Organism
StrainJA3453
Entry nameOxazolomycin
Contig
Start / Stop / Direction91,329 / 90,010 / - [in whole cluster]
91,329 / 90,010 / - [in contig]
Locationcomplement(90010..91329) [in whole cluster]
complement(90010..91329) [in contig]
TypeCDS
Length1,320 bp (439 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative threonine--tRNA ligase
putative threonyl-tRNA synthetase
Product (GenBank)threonyl-tRNA synthetase
Gene
Gene (GenBank)ozmT
EC number6.1.1.3
Keyword
Note
  • This ORF product lacks the Threonyl/alanyl tRNA synthetase, SAD domain (IPR012947) in the N-terminal region.
Note (GenBank)
Reference
ACC
PmId
[20406823] Oxazolomycin biosynthesis in Streptomyces albus JA3453 featuring an "acyltransferase-less" type I polyketide synthase that incorporates two distinct extender units. (J Biol Chem. , 2010)
Related Reference
ACC
P18255
PmId
[2115870] Independent genes for two threonyl-tRNA synthetases in Bacillus subtilis. (J Bacteriol. , 1990)

close this sectionSequence

selected fasta
>putative threonine--tRNA ligase [threonyl-tRNA synthetase]
MSRRAERCLEPKPRGECPGASSCAHSPLVRKETTMHDHRRLGRELELFDTDPLIGAGLPY
WLPDGAAVRHALEEYVRAAERRAGYRHVYSPVLGKRELYEISGHWSHYSEDMFPPMEVGG
EQMLLRPSLCPHHALIYRSRPRSHRELPLRMAELGGMYRAELSGVLGGLSRVRSIHLNDA
HVFCTLDQAAGEARAALEMIGRAYEALGIRPARFRLSLPGPGGKYVADPEKWRRSTALLT
EVLDASGVAYEAVEGEAAFYGPKIDVQIADGQGRESTLSTVQVDFHQPERFGLRYIGADG
AGHRPVMIHRSVIGSVERAVAHLVEEHGGAFPAWLAPVQIAVLPVTGAQVPDGEAFLRRC
AALGLRAEQADPGRGSLGARIRAARLVPYQVVIGEEEAADGRVALRLRDGRRVGPLPADE
ALARIDALVSAYGTGLWDR
selected fasta
>putative threonine--tRNA ligase [threonyl-tRNA synthetase]
GTGTCCCGGCGCGCTGAGCGATGTCTTGAGCCGAAGCCCCGGGGCGAGTGCCCCGGGGCT
TCGTCCTGCGCTCACTCGCCCCTCGTACGCAAGGAGACCACCATGCACGACCACCGCAGA
CTCGGCCGCGAGCTCGAACTGTTCGACACCGATCCGCTGATCGGCGCGGGACTGCCGTAC
TGGCTGCCCGACGGCGCCGCCGTACGCCACGCCCTGGAGGAGTACGTCCGCGCCGCCGAA
CGCCGGGCGGGCTACCGGCACGTGTACTCGCCGGTCCTCGGCAAGCGCGAGCTGTACGAG
ATCTCCGGGCACTGGTCGCACTACAGCGAGGACATGTTCCCGCCCATGGAGGTGGGCGGT
GAGCAGATGCTGCTGCGGCCGAGCCTCTGTCCGCACCACGCGCTCATCTACCGCTCCCGC
CCCCGCAGCCACCGCGAACTGCCGCTGCGCATGGCCGAACTCGGCGGCATGTACCGCGCC
GAGCTCTCCGGTGTCCTCGGCGGGCTGAGCCGTGTGCGGTCCATCCACCTCAACGACGCG
CACGTCTTCTGCACCCTGGACCAGGCCGCCGGGGAGGCGCGGGCCGCCCTGGAGATGATC
GGCCGGGCGTACGAGGCGCTGGGCATCCGCCCGGCGCGCTTCCGGCTCTCCCTGCCGGGG
CCCGGCGGCAAGTACGTCGCCGACCCCGAGAAGTGGCGCAGGTCCACCGCCCTGCTGACC
GAGGTCCTGGACGCCTCCGGGGTCGCGTACGAGGCCGTCGAGGGCGAGGCCGCCTTCTAC
GGGCCGAAGATCGACGTCCAGATCGCCGACGGGCAGGGCAGGGAGTCCACCCTCTCCACC
GTCCAGGTCGACTTCCACCAGCCCGAGCGGTTCGGCCTGCGCTACATCGGCGCGGACGGC
GCCGGGCACCGCCCGGTGATGATCCACCGCAGCGTCATCGGCAGCGTCGAGAGAGCCGTC
GCGCATCTCGTCGAGGAGCACGGCGGCGCCTTCCCCGCCTGGCTCGCCCCCGTGCAGATC
GCGGTGCTGCCGGTTACCGGGGCGCAGGTGCCGGACGGCGAGGCGTTCCTGCGGCGCTGT
GCGGCCCTGGGGCTGCGGGCCGAGCAGGCCGATCCCGGGCGCGGCAGCCTGGGCGCGCGG
ATCCGGGCGGCCAGGCTCGTCCCGTACCAGGTGGTCATCGGGGAGGAGGAGGCCGCCGAC
GGCCGGGTCGCCCTGCGGCTGCGCGACGGACGCCGCGTCGGCCCGCTGCCCGCCGACGAG
GCCCTGGCCCGGATCGACGCGCTGGTCTCGGCGTACGGGACCGGCCTCTGGGACCGGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002314 Aminoacyl-tRNA synthetase, class II (G/ H/ P/ S), conserved domain (Domain)
 [69-228]  1e-34 PF00587
PF00587   tRNA-synt_2b
IPR002320 Threonyl-tRNA synthetase, class IIa (Family)
 [125-153]  5.00000909915354e-44 PR01047 [158-181]  5.00000909915354e-44 PR01047 [262-290]  5.00000909915354e-44 PR01047 [305-318]  5.00000909915354e-44 PR01047 [332-344]  5.00000909915354e-44 PR01047
PR01047   TRNASYNTHTHR
 [30-427]  2.30000000000004e-129 TIGR00418
TIGR00418   ThrS
IPR004154 Anticodon-binding (Domain)
 [329-431]  3.7e-18 G3DSA:3.40.50.800
G3DSA:3.40.50.800   Anticodon_bd
 [327-439]  8.1000073432326e-22 SSF52954
SSF52954   Anticodon_bd
 [339-426]  4.40000000000001e-07 PF03129
PF03129   HGTP_anticodon
IPR006195 Aminoacyl-tRNA synthetase, class II (Domain)
 [63-332]  PS50862
PS50862   AA_TRNA_LIGASE_II
SignalP No significant hit
TMHMM No significant hit