close all open/close all

CDS information : Oxzol_00260


close this sectionLocation

Organism
StrainJA3453
Entry nameOxazolomycin
Contig
Start / Stop / Direction95,318 / 92,529 / - [in whole cluster]
95,318 / 92,529 / - [in contig]
Locationcomplement(92529..95318) [in whole cluster]
complement(92529..95318) [in contig]
TypeCDS
Length2,790 bp (929 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Productputative AfsR family transcriptional regulator
Product (GenBank)transcriptional activator
Gene
Gene (GenBank)ozmU
EC number
Keyword
  • SARP family
Note
Note (GenBank)
Reference
ACC
PmId
[20406823] Oxazolomycin biosynthesis in Streptomyces albus JA3453 featuring an "acyltransferase-less" type I polyketide synthase that incorporates two distinct extender units. (J Biol Chem. , 2010)
Related Reference
ACC
C1IC33
PmId
[19383687] polR, a pathway-specific transcriptional regulatory gene, positively controls polyoxin biosynthesis in Streptomyces cacaoi subsp. asoensis. (Microbiology. , 2009)
ACC
P25941
PmId
[2253887] Primary structure of AfsR, a global regulatory protein for secondary metabolite formation in Streptomyces coelicolor A3(2). (Gene. , 1990)
[17434533] AfsR recruits RNA polymerase to the afsS promoter: a model for transcriptional activation by SARPs. (J Mol Biol. , 2007)
[11952895] afsS is a target of AfsR, a transcriptional factor with ATPase activity that globally controls secondary metabolism in Streptomyces coelicolor A3(2). (Mol Microbiol. , 2002)

close this sectionSequence

selected fasta
>putative AfsR family transcriptional regulator [transcriptional activator]
MEFRLLGAVSVATEVGVLPLGPAKRRSLLAALLLRPNHPVPVDRLAAALWDDEPPPRSRG
VIQGHVSRLRVLLNGADAEMFGVELVTQGTAYVLRMPESLLDAHRFEELVTLARGQRAPA
DAVAMYQEALSLWQGPALTGAYPSQPLQAAAQALEELRLASVESLAGAWSRMGEHARAAA
VLRAEAGVHPLRESLSAALMRALQRAGRRTEALDWFHRTRRLLADELGVDPGRELADAYA
MALRGADASEEAEQGDGRQAGRGPARATVTVAPPPPAAAPVAVPAQSPATLPAAIDLLPR
MPRGFHGRAAELTALSRAAAGEAPVCLVTGPAGVGKTALVTHWAHRNRDQFPGGLLYTDL
RGFSDTGEPTLLEVLREFLLGLGVPPRRIPESASAASALFRSLCADRQLLVVLDNARASE
QVRDLLPGGARCVTVVTSRYRLRGLIASDAARPVPVDVLEPDDSAALLAAVLGTERVLAE
EVAARRLAELCGGLPLALRVAAARLADQPQSSLGAMGDELADESRRLSLLDVEDTGVRAA
LRLTVRRLPASAAHQFAHLGRHPGRYVDRYMAAALAGTDPAAAEAALDTLAAAHLVVRAA
PDRWTLHDLVRLYARGLDAGSDALVRVLDHTVVTVLAAADAAEPGDESCFTLPADFRAPR
GTRTFADREQAMAWYAAEREDLTLAATAADAAGLHGRTWRIVLGMWPQIVWRVRDGWTPL
LTTALGAARADADPRAEARVLALLGWVLTEEGRVGEALVHLEAAPPLAARADDPRGEATA
LINLSLAQAALGSPEDAAEGCAQAAALAHGVGDRSTERLALSHLARHHLDAGQWRAAHDT
ALTALGLDSPADTPVAARVLLLTSLGEAMVAMADEPGGIRRLEAAAREAEACGFDDGAVR
ALAALLRVSPDAGLQARHDAATARLTART
selected fasta
>putative AfsR family transcriptional regulator [transcriptional activator]
GTGGAATTTCGGCTGCTCGGAGCGGTCTCCGTCGCCACTGAGGTCGGGGTGCTGCCGCTG
GGGCCCGCCAAGCGGCGGAGCCTGCTCGCCGCCCTGTTGCTGCGGCCCAACCATCCGGTC
CCCGTCGACCGGTTGGCCGCGGCGCTCTGGGACGACGAGCCGCCGCCGCGCTCCCGCGGG
GTCATCCAGGGGCATGTGTCGCGGCTGCGCGTCCTGCTCAACGGTGCCGACGCCGAGATG
TTCGGCGTCGAACTGGTCACCCAGGGCACGGCGTACGTCCTGCGGATGCCGGAGTCCCTC
CTCGACGCCCACCGCTTCGAGGAACTGGTGACCCTGGCCCGCGGCCAGCGTGCGCCCGCC
GACGCCGTGGCGATGTACCAGGAGGCGCTGTCGCTGTGGCAGGGACCGGCGCTGACCGGC
GCCTATCCGAGCCAGCCGCTGCAGGCCGCGGCCCAGGCCCTCGAGGAGCTGCGCCTGGCC
TCCGTGGAGTCGCTGGCCGGTGCCTGGTCCCGGATGGGCGAGCACGCGAGGGCCGCCGCC
GTGCTGCGCGCCGAGGCCGGCGTGCACCCCCTGCGCGAGTCCCTGTCCGCCGCGCTGATG
CGGGCGTTGCAGCGGGCGGGGCGCCGCACCGAGGCCCTCGACTGGTTCCACCGCACCCGG
CGGCTGCTCGCCGACGAGCTGGGCGTCGATCCCGGCAGGGAACTGGCCGACGCGTACGCC
ATGGCGCTGCGCGGGGCGGACGCGAGCGAGGAGGCGGAGCAGGGCGACGGCCGGCAGGCG
GGGCGGGGCCCTGCGCGGGCCACCGTCACGGTCGCCCCTCCCCCGCCCGCGGCAGCGCCC
GTCGCCGTCCCCGCGCAGTCACCCGCCACGCTGCCTGCCGCGATCGACCTGCTGCCCCGC
ATGCCGCGCGGCTTCCACGGGCGGGCGGCCGAACTCACCGCGCTGTCGCGCGCCGCCGCG
GGCGAGGCACCCGTCTGTCTGGTCACCGGGCCCGCGGGCGTGGGCAAGACCGCGCTCGTG
ACGCACTGGGCGCACCGCAACCGCGACCAGTTCCCCGGCGGACTGCTCTACACCGACCTG
CGCGGCTTCAGCGACACGGGGGAACCGACGCTCCTGGAGGTGCTGCGCGAGTTCCTGCTC
GGCCTGGGGGTCCCGCCGCGCCGGATACCGGAGTCGGCGAGCGCCGCCTCCGCGCTGTTC
AGGTCCCTCTGCGCCGACCGCCAGCTCCTTGTCGTACTCGACAACGCGCGCGCCTCCGAG
CAGGTGCGCGACCTGCTGCCGGGCGGCGCCCGCTGTGTCACCGTCGTCACGAGCCGCTAC
CGGCTGCGCGGCCTGATCGCCTCCGACGCGGCGCGGCCCGTACCCGTGGACGTCCTCGAA
CCGGACGACAGCGCCGCTCTGCTCGCCGCCGTACTCGGCACGGAGCGGGTGCTCGCCGAG
GAGGTGGCCGCGCGGCGCCTCGCCGAACTCTGCGGTGGTCTGCCGCTCGCGCTGCGGGTG
GCCGCCGCCCGGCTCGCGGACCAGCCGCAGTCGTCGCTGGGCGCGATGGGCGACGAACTG
GCCGACGAGTCACGCCGGCTGAGCCTGCTCGACGTGGAGGACACGGGCGTACGCGCCGCG
CTGCGGCTGACCGTGCGCCGGCTGCCCGCGAGCGCCGCGCACCAGTTCGCGCACCTCGGC
CGCCACCCGGGCAGGTACGTCGACCGGTACATGGCGGCGGCCCTCGCGGGCACCGACCCG
GCGGCCGCCGAGGCCGCCCTCGACACGCTGGCCGCGGCCCATCTCGTCGTGCGGGCCGCG
CCCGACCGCTGGACGCTGCACGATCTCGTACGGCTGTACGCGCGCGGCCTGGACGCCGGG
AGCGACGCGCTGGTGCGGGTGCTCGACCACACCGTGGTCACCGTCCTCGCGGCGGCGGAC
GCGGCCGAGCCGGGCGACGAGTCCTGCTTCACGCTGCCCGCGGACTTCCGCGCGCCGCGG
GGGACGCGGACGTTCGCCGACCGCGAGCAGGCCATGGCCTGGTACGCGGCCGAGCGCGAG
GACCTGACCCTCGCGGCGACCGCCGCGGACGCCGCGGGGCTGCACGGCAGGACGTGGCGG
ATCGTCCTGGGGATGTGGCCGCAGATCGTCTGGCGGGTGCGGGACGGCTGGACTCCGCTG
CTCACCACGGCACTTGGCGCGGCGCGGGCCGACGCCGACCCCCGCGCGGAGGCGCGGGTC
CTCGCGCTGCTCGGGTGGGTGCTGACCGAGGAGGGCCGGGTCGGCGAGGCCCTGGTGCAC
CTGGAGGCCGCGCCCCCGCTCGCCGCGCGGGCCGACGACCCCAGGGGCGAGGCGACCGCG
CTGATCAACCTGTCCCTCGCGCAGGCCGCGCTCGGCAGCCCCGAGGACGCCGCGGAGGGC
TGCGCGCAGGCGGCGGCGCTGGCGCACGGCGTCGGCGACCGGAGCACCGAGCGGCTGGCG
CTCAGCCATCTCGCCCGGCACCATCTGGACGCCGGGCAGTGGCGGGCGGCCCACGACACG
GCCCTGACCGCGCTCGGCCTCGACTCCCCCGCGGACACCCCGGTCGCGGCCAGGGTCCTG
CTGCTCACCTCGCTCGGCGAGGCCATGGTGGCCATGGCCGACGAGCCGGGGGGCATCAGG
CGCCTGGAGGCCGCGGCCCGTGAAGCGGAGGCCTGCGGCTTCGACGACGGGGCGGTCCGC
GCGCTGGCCGCACTGCTGCGGGTCTCGCCGGACGCGGGCCTGCAGGCCCGCCATGACGCG
GCGACGGCGCGGCTGACCGCGCGGACATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000767 Disease resistance protein (Family)
 [325-340]  5.30000239467942e-07 PR00364 [403-417]  5.30000239467942e-07 PR00364 [491-505]  5.30000239467942e-07 PR00364
PR00364   DISEASERSIST
IPR001867 Signal transduction response regulator, C-terminal (Domain)
 [23-77]  4.29999999999999e-08 PF00486
PF00486   Trans_reg_C
 [15-94]  9.20000434662057e-08 SM00862
SM00862   Trans_reg_C
IPR002182 NB-ARC (Domain)
 [321-560]  2.2e-10 PF00931
PF00931   NB-ARC
IPR005158 Bacterial transcriptional activator domain (Domain)
 [101-243]  3.39999972437719e-39 SM01043
SM01043   BTAD
 [101-239]  9.50000000000005e-33 PF03704
PF03704   BTAD
IPR011990 Tetratricopeptide-like helical (Domain)
 [724-871]  1.5e-15 G3DSA:1.25.40.10
G3DSA:1.25.40.10   TPR-like_helical
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [24-84]  1.4e-05 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
IPR016032 Signal transduction response regulator, C-terminal effector (Domain)
 [1-95]  2.19999900980708e-11 SSF46894
SSF46894   Bipartite_resp_reg_C-effector
SignalP
 [1-30]  0.325 Signal
Bacteria, Gram-positive   
 [1-39]  0.672 Signal
Eukaryota   
TMHMM No significant hit