close all open/close all

CDS information : Oxzol_00270


close this sectionLocation

Organism
StrainJA3453
Entry nameOxazolomycin
Contig
Start / Stop / Direction95,512 / 96,849 / + [in whole cluster]
95,512 / 96,849 / + [in contig]
Location95512..96849 [in whole cluster]
95512..96849 [in contig]
TypeCDS
Length1,338 bp (445 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative cytochrome P450
Product (GenBank)cytochrome P450
Gene
Gene (GenBank)ozmV
EC number
Keyword
Note
  • This ORF is not involved in oxazolomycin biosynthesis.
Note (GenBank)
Reference
ACC
PmId
[20406823] Oxazolomycin biosynthesis in Streptomyces albus JA3453 featuring an "acyltransferase-less" type I polyketide synthase that incorporates two distinct extender units. (J Biol Chem. , 2010)
Related Reference
ACC
O31440
PmId
[10529095] Characterization of the ybdT gene product of Bacillus subtilis: novel fatty acid beta-hydroxylating cytochrome P450. (Lipids. , 1999)
[12519760] Substrate recognition and molecular mechanism of fatty acid hydroxylation by cytochrome P450 from Bacillus subtilis. Crystallographic, spectroscopic, and mutational studies. (J Biol Chem. , 2003)
ACC
O24782
PmId
[9295298] Molecular cloning and expression of fatty acid alpha-hydroxylase from Sphingomonas paucimobilis. (J Biol Chem. , 1997)

close this sectionSequence

selected fasta
>putative cytochrome P450 [cytochrome P450]
MTCTGAPVPAGFWETPPPVHVTARVCVTQEDLMLDNTLPLLTRGYAWLPDLSRREGPGAV
RTRLMGKPAIALRGPAAVGFFYDEDHVRRRTALPEPVLATLFGKTAVHTLDGAEHRKRKE
LFIKVLKDTSGVTALAERVADEWERSCKEWSDRARVTLFDEVSVLITRAVCAWAGVPLTE
GPEGDARRTAQDLVLMVDGFATAGPRHWRARRARQRQEERLARLVEDIRSAGGKTTGEGG
PPTTAVEAVAVHRDADGELLEPRTAAVEILNIIRPTVAVTWYTVFGAHALHRNPSLRQRL
ATGGEGYARAFAHEVRRFYPFAPFVAGLAPRDVEWHGEHIAEGSLVLLDLYGQNHDPELW
EAPYTFDPERFVGREPGRDELVPQGGGEASQGHRCPGEDVTLAVLSTLLPRLARLDYRVP
DQDLRIPLNRMPTRPRSGFVIAETH
selected fasta
>putative cytochrome P450 [cytochrome P450]
GTGACATGCACGGGTGCCCCGGTTCCGGCAGGCTTCTGGGAGACGCCACCACCCGTCCAC
GTCACGGCCCGCGTATGTGTCACCCAGGAGGACCTCATGCTGGACAACACGCTGCCGCTC
CTGACGCGGGGCTACGCGTGGCTTCCCGATCTGAGCCGCCGCGAGGGTCCGGGCGCCGTC
CGCACCCGTCTGATGGGCAAGCCCGCCATCGCGCTGCGCGGCCCCGCCGCCGTCGGGTTC
TTCTACGACGAGGACCATGTACGCCGTCGCACGGCCCTGCCCGAACCCGTTCTCGCCACC
CTCTTCGGCAAGACCGCGGTGCACACCCTGGACGGGGCGGAGCACCGTAAACGCAAGGAA
CTGTTCATCAAGGTGCTCAAGGACACCTCCGGCGTCACCGCATTGGCGGAGCGGGTCGCC
GACGAGTGGGAGCGGTCCTGCAAGGAGTGGTCCGACCGGGCCAGGGTGACGCTCTTCGAC
GAGGTGAGTGTCCTGATCACCCGGGCCGTGTGCGCCTGGGCGGGGGTCCCGCTCACCGAA
GGACCCGAGGGCGACGCGCGGCGGACCGCCCAGGACCTGGTCCTCATGGTCGACGGTTTC
GCCACGGCGGGCCCGCGGCACTGGCGGGCCCGGCGCGCCAGGCAGCGCCAGGAGGAGCGG
CTGGCCCGGCTGGTCGAGGACATCAGGTCGGCCGGCGGCAAGACGACCGGCGAGGGCGGC
CCGCCGACCACCGCCGTGGAGGCCGTGGCCGTCCACCGGGACGCCGACGGCGAGCTCCTC
GAACCGCGTACGGCGGCGGTGGAGATCCTCAACATCATCCGGCCGACGGTCGCCGTCACC
TGGTACACGGTGTTCGGCGCCCACGCCCTGCACCGCAACCCGTCGCTGCGGCAGCGCCTG
GCCACGGGCGGGGAGGGCTACGCGCGAGCGTTCGCCCACGAGGTGCGGCGCTTCTACCCG
TTCGCACCGTTCGTCGCGGGCCTCGCCCCGCGCGACGTCGAATGGCACGGCGAGCACATC
GCCGAGGGCTCCCTGGTCCTCCTCGACCTGTACGGGCAGAACCACGACCCCGAGCTGTGG
GAGGCCCCGTACACCTTCGACCCCGAGCGGTTCGTGGGCCGCGAGCCGGGGCGCGACGAG
CTCGTGCCGCAGGGCGGCGGCGAGGCCTCCCAGGGGCATCGCTGCCCGGGCGAGGACGTC
ACGCTGGCGGTCCTGAGCACCCTGCTGCCGCGCCTGGCGCGGCTCGACTACCGGGTGCCC
GACCAGGATTTGCGCATCCCGTTGAACCGGATGCCCACCAGGCCGCGCAGCGGTTTCGTC
ATCGCGGAGACGCACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001128 Cytochrome P450 (Family)
 [17-445]  4.90001027782408e-53 SSF48264
SSF48264   Cytochrome_P450
 [307-387]  3.2e-11 PF00067
PF00067   p450
 [33-441]  2.1e-53 G3DSA:1.10.630.10
G3DSA:1.10.630.10   Cyt_P450
IPR002401 Cytochrome P450, E-class, group I (Family)
 [220-237]  3.50000235434314e-10 PR00463 [309-327]  3.50000235434314e-10 PR00463 [349-373]  3.50000235434314e-10 PR00463
PR00463   EP450I
SignalP
 [1-23]  0.163 Signal
Bacteria, Gram-positive   
TMHMM No significant hit