close all open/close all

CDS information : Oxzol_00280


close this sectionLocation

Organism
StrainJA3453
Entry nameOxazolomycin
Contig
Start / Stop / Direction97,134 / 97,799 / + [in whole cluster]
97,134 / 97,799 / + [in contig]
Location97134..97799 [in whole cluster]
97134..97799 [in contig]
TypeCDS
Length666 bp (221 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative hydrolase
Product (GenBank)putative hydroxylase
Gene
Gene (GenBank)ozmW
EC number
Keyword
Note
  • This ORF is not involved in oxazolomycin biosynthesis.
Note (GenBank)
Reference
ACC
PmId
[20406823] Oxazolomycin biosynthesis in Streptomyces albus JA3453 featuring an "acyltransferase-less" type I polyketide synthase that incorporates two distinct extender units. (J Biol Chem. , 2010)
Family/Domain
FD
IPR006439

close this sectionSequence

selected fasta
>putative hydrolase [putative hydroxylase]
MARAALFDVDGTLTDTNHLHVVAWWEAFRQAGHTVAMRDIHHAIGLGSADLVAHCLGEDR
DRAGDEEISAAHSALYGTYFNRLAALDGARDLLHALHERGLRIVLATSAGGFELAALRRA
IDADDVIAGVASADDVSSGKPAPDPVQHALDIAECAAEDALFVGDSVWDMRAATKAGVRA
FALLSGGIPRADLEAAGATAVYADPADLLKHLDSEVLAGRE
selected fasta
>putative hydrolase [putative hydroxylase]
ATGGCGCGTGCGGCGCTCTTCGATGTCGACGGAACTCTGACCGACACCAACCACCTGCAT
GTGGTGGCCTGGTGGGAGGCGTTCCGTCAGGCGGGCCACACGGTGGCGATGCGCGACATC
CACCACGCCATCGGCCTCGGCTCGGCCGACCTCGTCGCCCACTGCCTCGGCGAGGACCGC
GACCGTGCGGGCGACGAGGAGATCAGCGCCGCGCACAGCGCCCTGTACGGCACGTACTTC
AACCGTCTGGCGGCCCTCGACGGTGCGCGTGACCTGCTGCACGCCCTGCACGAGCGCGGT
CTGCGCATCGTCCTCGCCACCTCGGCGGGCGGGTTCGAGCTGGCCGCGCTGCGCCGGGCC
ATCGACGCCGACGACGTCATCGCGGGCGTGGCGAGCGCGGACGACGTGTCATCGGGCAAG
CCCGCCCCCGACCCCGTCCAGCACGCCCTGGACATCGCGGAATGCGCCGCCGAGGACGCC
CTCTTCGTCGGCGACTCCGTATGGGACATGCGGGCGGCCACCAAGGCGGGCGTCCGCGCC
TTCGCCCTGCTCTCGGGCGGCATCCCGCGCGCCGACCTGGAGGCGGCCGGCGCCACCGCG
GTCTACGCGGACCCCGCCGACCTGCTGAAGCACCTGGACAGTGAGGTCCTCGCGGGCCGG
GAGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR006439 HAD-superfamily hydrolase, subfamily IA, variant 1 (Family)
 [84-177]  4e-06 TIGR01549
TIGR01549   HAD-SF-IA-v1
IPR023214 HAD-like domain (Domain)
 [1-214]  4.90001027782408e-47 SSF56784
SSF56784   HAD-like_dom
 [2-16]  5.40000000000002e-35 G3DSA:3.40.50.1000 [82-214]  5.40000000000002e-35 G3DSA:3.40.50.1000
G3DSA:3.40.50.1000   HAD-like_dom
SignalP No significant hit
TMHMM No significant hit