close all open/close all

CDS information : Oxzol_00290


close this sectionLocation

Organism
StrainJA3453
Entry nameOxazolomycin
Contig
Start / Stop / Direction98,166 / 99,014 / + [in whole cluster]
98,166 / 99,014 / + [in contig]
Location98166..99014 [in whole cluster]
98166..99014 [in contig]
TypeCDS
Length849 bp (282 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative RNA polymerase sigma factor
Product (GenBank)RNA polymerase sigma factor
Gene
Gene (GenBank)
EC number
Keyword
Note
  • This ORF is not involved in oxazolomycin biosynthesis.
Note (GenBank)
  • ozm orf +1
Reference
ACC
PmId
[20406823] Oxazolomycin biosynthesis in Streptomyces albus JA3453 featuring an "acyltransferase-less" type I polyketide synthase that incorporates two distinct extender units. (J Biol Chem. , 2010)
Related Reference
ACC
O52313
PmId
[10188243] A new gene, sigG, encoding a putative alternative sigma factor of Streptomyces coelicolor A3(2). (FEMS Microbiol Lett. , 1999)
ACC
Q9RPC8
PmId
[10913862] Identification and transcriptional characterization of the gene encoding the stress-response sigma factor sigma(H) in streptomyces coelicolor A3(2). (FEMS Microbiol Lett. , 2000)
[11797050] Stress-response sigma factor sigma(H) is essential for morphological differentiation of Streptomyces coelicolor A3(2). (Arch Microbiol. , 2001)
ACC
Q840Q3
PmId
[14597396] Involvement of sigma(H) and related sigma factors in glucose-dependent initiation of morphological and physiological development of Streptomyces griseus. (Gene. , 2003)

close this sectionSequence

selected fasta
>putative RNA polymerase sigma factor [RNA polymerase sigma factor]
MLTDLTEYSARRRSANQHSHSDAPDTAVEFARLASLGSGPEREALCAEIVEAWLPMAHRI
AGRFRNKGESLEDLQQVAAMGLVKAVNRYEPGRGAFESYAVPTITGELRRHFRDRMWDVR
VPRRVQELRNKVRAARRELLDRPGGSGREPTLAEIGEQAELTEAEVRDGMEAMEGYSALS
LDAEVSSAEPDGFSLADTLGAPDPAYDHINDREAAKAGLRRLPERERTILYLRYFEDMTQ
SRIAEELGISQMHVSRLISRSCARVRAEADPGLADAGRPEAA
selected fasta
>putative RNA polymerase sigma factor [RNA polymerase sigma factor]
ATGCTCACAGACCTCACCGAATACTCCGCACGTCGCCGCTCGGCGAATCAGCACTCCCAC
AGCGACGCTCCCGACACGGCGGTGGAATTCGCCCGCCTGGCCTCTCTCGGGAGCGGCCCC
GAACGCGAGGCGCTCTGCGCCGAGATCGTCGAGGCGTGGCTGCCGATGGCGCACCGGATC
GCCGGGCGCTTCCGCAACAAGGGCGAGAGCCTCGAAGACCTCCAGCAGGTCGCCGCGATG
GGCCTGGTGAAGGCGGTCAACCGGTACGAGCCCGGGCGGGGCGCGTTCGAGAGCTACGCG
GTCCCCACCATCACCGGTGAACTGCGGCGCCACTTCCGCGACCGCATGTGGGACGTGCGG
GTCCCCCGGCGCGTACAGGAACTGCGCAACAAGGTCCGCGCCGCGCGCCGTGAACTCCTC
GACCGGCCGGGCGGCAGCGGCCGCGAACCCACCCTCGCGGAGATCGGCGAGCAGGCGGAA
CTCACCGAGGCCGAGGTCCGCGACGGCATGGAGGCCATGGAGGGCTACAGCGCCCTGTCG
CTCGACGCCGAGGTCTCCTCCGCCGAGCCCGACGGGTTCAGCCTCGCCGACACGCTCGGG
GCGCCCGACCCCGCGTACGACCACATCAACGACCGCGAGGCGGCCAAGGCGGGCCTGCGG
CGGCTCCCCGAGCGCGAGCGGACCATCCTCTACCTGCGCTACTTCGAGGACATGACGCAG
AGCCGGATCGCCGAGGAACTCGGCATCTCGCAGATGCACGTCTCGCGCCTGATCAGCCGG
AGCTGCGCCCGCGTGCGCGCGGAGGCCGACCCCGGGCTCGCGGACGCGGGGCGGCCCGAA
GCGGCGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000943 RNA polymerase sigma-70 factor (Domain)
 [73-86]  4.99999811956429e-06 PR00046 [222-234]  4.99999811956429e-06 PR00046 [239-254]  4.99999811956429e-06 PR00046
PR00046   SIGMA70FCT
IPR007624 RNA polymerase sigma-70 region 3 (Domain)
 [127-193]  1.3e-09 PF04539
PF04539   Sigma70_r3
IPR007627 RNA polymerase sigma-70 region 2 (Domain)
 [49-117]  1.8e-16 PF04542
PF04542   Sigma70_r2
IPR007630 RNA polymerase sigma-70 region 4 (Domain)
 [219-267]  7e-17 PF04545
PF04545   Sigma70_r4
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [117-173]  1.1e-16 G3DSA:1.10.10.10 [222-265]  3.7e-09 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
IPR013324 RNA polymerase sigma factor, region 3/4 (Domain)
 [121-202]  8.1000073432326e-13 SSF88659 [185-271]  1.59999889349252e-13 SSF88659
SSF88659   Sigma_r3_r4
IPR013325 RNA polymerase sigma factor, region 2 (Domain)
 [40-118]  4.60000044330862e-21 SSF88946
SSF88946   Sigma_r2
IPR014284 RNA polymerase sigma-70 (Domain)
 [46-266]  1.2e-31 TIGR02937
TIGR02937   Sigma70-ECF
IPR014322 RNA polymerase sigma-B/F/G type (Family)
 [45-268]  1.9e-79 TIGR02980
TIGR02980   SigBFG
SignalP No significant hit
TMHMM No significant hit