close all open/close all

CDS information : Oxzol_00300


close this sectionLocation

Organism
StrainJA3453
Entry nameOxazolomycin
Contig
Start / Stop / Direction99,471 / 100,505 / + [in whole cluster]
99,471 / 100,505 / + [in contig]
Location99471..100505 [in whole cluster]
99471..100505 [in contig]
TypeCDS
Length1,035 bp (344 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)putative DNA polymerase beta chain
Gene
Gene (GenBank)
EC number
Keyword
Note
  • This ORF is not involved in oxazolomycin biosynthesis.
Note (GenBank)
  • ozm orf +2
Reference
ACC
PmId
[20406823] Oxazolomycin biosynthesis in Streptomyces albus JA3453 featuring an "acyltransferase-less" type I polyketide synthase that incorporates two distinct extender units. (J Biol Chem. , 2010)

close this sectionSequence

selected fasta
>hypothetical protein [putative DNA polymerase beta chain]
MPMEPVEALERIAFLLERGRAPTYRVRAFRTAAAVIAGLADGEAARRAGDGSLERLKGVG
PKTAGVVREALAGGVPGYLERLEGEADAPLAEGGSTLRSLLRGDCHLHSDWSDGGSPIEE
MGRAARAVGHEWAALTDHSPRLTIARGLSPERLREQLDVVAALNETWAPFRLLTGIECDI
LDDGSLDQEPELLDRLDVVVVSVHSKLRMDAAAMTRRMVRAVRDPRADVLGHCTGRLVTG
RGRPESQFDADEVFAACAEADTAVEINSRPERLDPPRGLLKRAVAAGTLFSVDTDAHAPG
QLDWQVIGCARAEECGVPAERVVTTWTADEVVAWTRRSRAGATA
selected fasta
>hypothetical protein [putative DNA polymerase beta chain]
GTGCCGATGGAACCCGTGGAGGCGTTGGAACGGATCGCCTTTCTGCTGGAGCGGGGCCGC
GCCCCGACCTACCGCGTACGGGCCTTCCGCACCGCGGCGGCGGTGATCGCGGGCCTGGCC
GACGGCGAGGCCGCGCGGCGCGCCGGGGACGGCAGCCTGGAGAGGCTCAAGGGCGTCGGG
CCCAAGACCGCCGGCGTGGTCCGCGAGGCCCTCGCCGGCGGTGTCCCCGGCTATCTGGAG
CGGCTCGAAGGCGAGGCCGACGCCCCGCTCGCCGAGGGCGGGAGCACACTGCGGTCGCTG
CTGCGCGGCGACTGCCACCTGCACTCCGACTGGTCCGACGGCGGCAGCCCGATCGAGGAG
ATGGGCCGCGCGGCCCGTGCGGTCGGCCACGAGTGGGCGGCCCTCACCGACCACTCGCCG
CGCCTGACCATCGCCCGCGGCCTGTCGCCCGAGCGGCTGCGCGAGCAGCTGGACGTGGTG
GCCGCGCTCAACGAGACGTGGGCCCCCTTCCGGCTCCTCACCGGCATCGAGTGCGACATC
CTCGACGACGGCTCCCTCGACCAGGAACCCGAGCTGCTCGACCGCCTCGACGTGGTCGTC
GTGTCGGTGCACTCCAAGCTGCGGATGGACGCCGCCGCGATGACCCGTCGCATGGTCCGC
GCCGTGCGCGACCCCCGTGCCGACGTGCTCGGGCACTGCACGGGACGGCTGGTCACCGGA
CGCGGCAGACCCGAGTCGCAGTTCGACGCGGACGAGGTCTTCGCCGCCTGCGCCGAGGCG
GACACGGCGGTGGAGATCAACAGCCGCCCCGAGCGGCTCGACCCGCCGCGCGGACTGCTG
AAGCGCGCCGTGGCGGCGGGCACCCTCTTCTCCGTCGACACCGACGCGCACGCCCCCGGC
CAGCTCGACTGGCAGGTCATCGGGTGCGCGCGGGCCGAGGAGTGCGGGGTCCCCGCCGAG
CGGGTGGTCACGACCTGGACGGCGGACGAGGTGGTGGCCTGGACCCGGAGGAGCCGGGCC
GGGGCCACCGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003141 Polymerase/histidinol phosphatase, N-terminal (Domain)
 [103-182]  1.99999636034521e-18 SM00481
SM00481   POLIIIAc
IPR003583 Helix-hairpin-helix DNA-binding motif, class 1 (Domain)
 [51-70]  0.00159999977185866 SM00278
SM00278   HhH1
IPR004013 PHP, C-terminal (Domain)
 [104-274]  6.50000000000001e-16 PF02811
PF02811   PHP
IPR010996 DNA-directed DNA polymerase, family X, beta-like, N-terminal (Domain)
 [4-81]  1.80000149287196e-13 SSF47802
SSF47802   DNApol_B_N_like
 [5-84]  7.90000000000001e-12 G3DSA:1.10.150.110
G3DSA:1.10.150.110   DNA_pol_b_N-like
IPR016195 Polymerase/histidinol phosphatase-like (Domain)
 [101-339]  1.49999648196323e-48 SSF89550
SSF89550   PHP-like
IPR017078 Uncharacterised conserved protein UCP036978, histidinol phosphatase-related hydrolase, SCO0789 (Family)
 [1-339]  PIRSF036978
PIRSF036978   UCP036978_PHPhdr
SignalP No significant hit
TMHMM No significant hit