close all open/close all

CDS information : Oxzol_00310


close this sectionLocation

Organism
StrainJA3453
Entry nameOxazolomycin
Contig
Start / Stop / Direction102,616 / 100,514 / - [in whole cluster]
102,616 / 100,514 / - [in contig]
Locationcomplement(100514..102616) [in whole cluster]
complement(100514..102616) [in contig]
TypeCDS
Length2,103 bp (700 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative oxidoreductase
Product (GenBank)putative oxidoreductase
Gene
Gene (GenBank)
EC number
Keyword
Note
  • This ORF is not involved in oxazolomycin biosynthesis.
Note (GenBank)
  • ozm orf +3
Reference
ACC
PmId
[20406823] Oxazolomycin biosynthesis in Streptomyces albus JA3453 featuring an "acyltransferase-less" type I polyketide synthase that incorporates two distinct extender units. (J Biol Chem. , 2010)
Related Reference
ACC
Q46799
PmId
[10986234] Purine catabolism in Escherichia coli and function of xanthine dehydrogenase in purine salvage. (J Bacteriol. , 2000)

close this sectionSequence

selected fasta
>putative oxidoreductase [putative oxidoreductase]
MPDTTSALGAPTERREGPAKVTGAAPYAAEHTPEGCAYAWPVPATVARGEITSVDDTAAL
AVPGVVGVLTHLNAPRLAEADDAILAVLQDARVPHRGWYVALVVADTLEAAREGAAAVTV
TYSEEPHDVTLDAGSPAAYVPEDPDGNPDEHTRGDPDAALAAAPTQVDVTYEVPPLHNHP
MEPHAATAHWQDGRLTAYDSSQGATAVRQTLASLFKLPEEQVTVVSEHVGGGFGAKGTPR
PHVVLAAMAARETGRPVKLALPRRHLATVVGHRSPTVQRLRLGAEADGTLTSVIHEVTSY
TSRIKEFVETGAAVSRVMYPSPHARTGHRVLPLDVPSPSWMRAPGEAPGMYALESAMDEL
AVALGMDPVELRLRNDTDKEPDSGKPFSSRHLAECLREGARRFGWAERDPRPRSRTEGPL
LIGTGVAAATYPVLVSPSRASARAYPDGGYVVRVNATDIGTGARTVLAQVAADALGVPVD
RVRTEVGSTDLPAAPLAGGSSGTASWGWAVHEACTRLAERLAGQREQRLPPEGVGASADT
EGTSDTNYAESDYARHAFGAHFAEVGVDSVSGEVRVRRLLGVYAAGHILNARTARSQFIG
GMTMGLGMALTEHSTMDEPFGDFAESDLASYHVPVHADVPAIEAHWIDEDDPHLNPMGSK
GIGEIGIVGTAAAIGNAVHHATGVRVRELPVTPDKILTGS
selected fasta
>putative oxidoreductase [putative oxidoreductase]
ATGCCGGACACCACCAGCGCTCTCGGGGCGCCCACCGAGCGCAGGGAGGGCCCCGCCAAG
GTGACAGGGGCCGCCCCCTACGCCGCCGAGCACACGCCCGAGGGCTGCGCCTACGCCTGG
CCCGTGCCCGCCACCGTCGCGCGCGGCGAGATCACCTCCGTCGACGACACGGCGGCCCTC
GCGGTGCCCGGTGTCGTCGGCGTCCTGACGCACCTCAACGCGCCGCGCCTCGCCGAGGCC
GACGACGCCATCCTCGCCGTGCTCCAGGACGCCCGCGTCCCGCACCGGGGCTGGTACGTC
GCCCTCGTCGTCGCCGACACCCTGGAGGCGGCCCGCGAAGGCGCCGCCGCCGTCACGGTC
ACGTACTCCGAGGAACCGCACGACGTCACCCTGGACGCCGGGAGCCCCGCCGCCTACGTG
CCCGAGGATCCCGACGGCAACCCGGACGAGCACACGCGCGGGGACCCCGACGCGGCCCTC
GCCGCCGCGCCCACCCAGGTGGACGTGACATACGAGGTGCCGCCGCTGCACAACCACCCC
ATGGAGCCGCACGCGGCCACCGCCCACTGGCAGGACGGGCGGCTGACCGCGTACGACTCC
AGCCAGGGCGCCACCGCCGTCCGCCAGACCCTGGCGAGCCTCTTCAAGCTGCCCGAGGAG
CAGGTCACCGTCGTCTCCGAACACGTCGGCGGCGGCTTCGGCGCCAAGGGCACGCCACGG
CCGCACGTCGTGCTCGCCGCCATGGCCGCGCGCGAGACGGGGCGGCCGGTCAAACTCGCC
CTGCCCCGGCGCCACCTGGCGACCGTGGTGGGTCACCGTTCGCCGACCGTGCAGCGGCTG
CGGCTCGGGGCGGAGGCGGACGGCACGCTGACGTCCGTGATCCACGAGGTGACCTCGTAC
ACCTCGCGCATCAAGGAGTTCGTGGAGACGGGCGCCGCCGTCTCCCGCGTCATGTATCCC
TCGCCACACGCCCGCACCGGCCACCGGGTGCTGCCGCTCGACGTGCCGAGCCCCTCATGG
ATGCGTGCCCCCGGCGAAGCGCCGGGCATGTACGCCCTGGAGTCCGCCATGGACGAGCTC
GCCGTGGCGCTCGGCATGGACCCCGTCGAGCTGCGGCTGCGCAACGACACCGACAAAGAG
CCCGACAGCGGCAAGCCGTTCAGCAGCCGCCACCTCGCCGAGTGCCTGCGCGAGGGCGCG
CGCCGCTTCGGCTGGGCCGAGCGCGACCCGCGGCCCCGCTCACGGACCGAGGGCCCCCTC
CTGATCGGCACCGGGGTCGCCGCGGCGACCTACCCGGTGCTCGTCTCCCCCTCCCGGGCG
AGCGCCCGCGCCTACCCGGACGGCGGCTACGTGGTCCGGGTCAACGCCACCGACATCGGT
ACGGGCGCCCGTACCGTGCTCGCCCAGGTCGCCGCCGACGCGCTCGGCGTTCCCGTGGAC
CGCGTGCGCACCGAGGTCGGCAGCACCGACCTGCCCGCGGCGCCGCTCGCGGGCGGCTCC
TCCGGCACCGCCTCCTGGGGCTGGGCCGTCCACGAGGCCTGTACGCGGCTCGCCGAGCGC
CTGGCCGGACAGCGGGAGCAGCGACTGCCGCCGGAGGGCGTCGGCGCGTCGGCCGACACG
GAGGGCACGTCCGACACCAACTACGCGGAGAGCGACTACGCGCGGCACGCCTTCGGCGCG
CACTTCGCGGAGGTCGGCGTCGACTCCGTATCGGGCGAGGTCCGTGTGCGCAGGCTGCTC
GGCGTCTACGCGGCGGGGCACATCCTCAACGCCCGTACCGCGCGCTCGCAGTTCATCGGC
GGGATGACCATGGGGCTGGGCATGGCCCTGACCGAGCACAGCACCATGGACGAGCCTTTC
GGTGACTTCGCGGAGAGCGACCTCGCCTCCTACCACGTACCGGTGCACGCCGACGTGCCC
GCGATCGAGGCGCACTGGATCGACGAGGACGACCCGCACCTGAACCCCATGGGCAGCAAG
GGCATCGGTGAGATCGGCATCGTCGGCACGGCCGCGGCGATCGGCAACGCCGTGCACCAT
GCCACCGGGGTGCGGGTGCGGGAGCTGCCGGTCACACCGGACAAGATCCTGACCGGTTCC
TGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000674 Aldehyde oxidase/xanthine dehydrogenase, a/b hammerhead (Domain)
 [3-114]  5.90000000000001e-30 G3DSA:3.90.1170.50
G3DSA:3.90.1170.50   Aldxan_DH_hamm
 [1-148]  4.09999599045784e-32 SSF54665
SSF54665   Aldxan_dh_hamm
 [22-126]  7.60000011115808e-33 SM01008
SM01008   Ald_Xan_dh_C
 [22-126]  3.39999999999999e-17 PF01315
PF01315   Ald_Xan_dh_C
IPR008274 Aldehyde oxidase/xanthine dehydrogenase, molybdopterin binding (Domain)
 [115-190]  8.20000000000001e-13 G3DSA:3.30.365.10 [191-264]  1.99999999999999e-30 G3DSA:3.30.365.10 [344-431]  8.1e-64 G3DSA:3.30.365.10 [436-565]  1.3e-27 G3DSA:3.30.365.10 [566-698]  8.1e-64 G3DSA:3.30.365.10
G3DSA:3.30.365.10   Ald_xan_DH_mo_bd
 [118-698]  SSF56003
SSF56003   Ald_xan_DH_mo_bd
 [147-528]  2.79999999999994e-75 PF02738 [535-640]  1.1e-21 PF02738
PF02738   Ald_Xan_dh_C2
SignalP No significant hit
TMHMM No significant hit