close all open/close all

CDS information : Oxzol_00320


close this sectionLocation

Organism
StrainJA3453
Entry nameOxazolomycin
Contig
Start / Stop / Direction103,640 / 102,645 / - [in whole cluster]
103,640 / 102,645 / - [in contig]
Locationcomplement(102645..103640) [in whole cluster]
complement(102645..103640) [in contig]
TypeCDS
Length996 bp (331 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative oxidoreductase
Product (GenBank)oxidoreductase
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in oxazolomycin biosynthesis.
Note (GenBank)
  • ozm orf +4
Reference
ACC
Related Reference
ACC
O33820
PmId
[9490068] 4-Hydroxybenzoyl-CoA reductase (dehydroxylating) from the denitrifying bacterium Thauera aromatica--prosthetic groups, electron donor, and genes of a member of the molybdenum-flavin-iron-sulfur proteins. (Eur J Biochem. , 1998)
ACC
P19914
PmId
[10482497] Cloning and molecular characterization of the genes for carbon monoxide dehydrogenase and localization of molybdopterin, flavin adenine dinucleotide, and iron-sulfur centers in the enzyme of Hydrogenophaga pseudoflava. (J Bacteriol. , 1999)

close this sectionSequence

selected fasta
>putative oxidoreductase [oxidoreductase]
MKSFRYLRAHSVDEATAAHAGRPGSRYLGGGTNLVDLMKTGVERPETLIDVSRLPLDAVE
ELSDGSVRAGAAVRNSDLAAHPLVRDRYPVLAQALLSGASGQLRNAATTGGNLLQRTRCP
YFQDLGKPCNKREPGSGCGARDGVHRDHAVLGHSPQCIATHPSDMAVALAALDAQVELHG
AKGRRTVPAAEFHRLPGDRPDLDTEIAPGELITGVRLPATTAGLPSAYRKARDRASYAFA
LASVAVVLDVEDSRVREVRIAFGGLAHRPWRALRAERALLGGPVTEEAFRQAVDEELAAA
EPLPDNAFKVPLARNIACDVLRRLSTASAAA
selected fasta
>putative oxidoreductase [oxidoreductase]
ATGAAGTCCTTCAGGTATCTGCGCGCCCACAGCGTCGACGAGGCGACCGCGGCGCACGCG
GGGCGCCCCGGCTCCCGCTATCTCGGCGGCGGCACCAACCTCGTCGACCTGATGAAGACG
GGCGTGGAGCGGCCCGAGACGCTGATCGACGTCAGCAGGCTGCCGCTGGACGCGGTCGAG
GAGCTGTCCGACGGCTCGGTGCGGGCCGGGGCGGCGGTGCGCAACAGCGACCTCGCCGCC
CACCCGCTGGTGCGCGACCGCTACCCCGTCCTCGCCCAGGCGCTGCTCTCGGGCGCGTCG
GGGCAGCTCCGCAACGCGGCGACGACCGGCGGCAACCTGCTCCAGCGCACCCGCTGCCCC
TACTTCCAGGACCTGGGCAAGCCGTGCAACAAGCGGGAGCCCGGCAGCGGCTGCGGTGCC
CGTGACGGCGTCCACCGCGACCACGCGGTGCTCGGGCACTCGCCGCAGTGCATCGCCACG
CACCCCTCCGACATGGCGGTCGCCCTCGCCGCGCTCGACGCCCAGGTGGAGCTGCACGGG
GCGAAGGGCCGGCGGACCGTGCCCGCCGCCGAGTTCCACCGGCTGCCCGGGGACCGCCCC
GACCTGGACACCGAGATCGCGCCCGGTGAACTCATCACCGGCGTACGGCTCCCCGCCACG
ACGGCCGGCCTGCCCTCCGCCTACCGCAAGGCACGCGACCGCGCCTCGTACGCCTTCGCG
CTCGCCTCCGTGGCCGTGGTCCTCGACGTCGAGGACTCCCGCGTACGCGAGGTGCGGATC
GCGTTCGGCGGCCTCGCGCATCGGCCCTGGCGCGCGCTGCGCGCCGAACGCGCGCTGCTG
GGCGGCCCGGTGACCGAGGAGGCGTTCCGGCAGGCCGTCGACGAGGAGCTCGCCGCCGCC
GAACCGCTGCCGGACAACGCGTTCAAGGTGCCCCTCGCCCGCAACATCGCCTGCGACGTC
CTGCGGCGCCTGAGCACGGCGTCCGCCGCCGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002346 Molybdopterin dehydrogenase, FAD-binding (Domain)
 [3-219]  1.5e-53 PF00941
PF00941   FAD_binding_5
IPR005107 CO dehydrogenase flavoprotein, C-terminal (Domain)
 [223-324]  1.10000150671642e-27 SSF55447
SSF55447   CO_deh_flav_C
 [227-323]  2.5e-28 G3DSA:3.30.390.50
G3DSA:3.30.390.50   CO_DH_flav_C
 [226-324]  4.60000044330862e-32 SM01092
SM01092   CO_deh_flav_C
 [226-322]  3.09999999999998e-19 PF03450
PF03450   CO_deh_flav_C
IPR016166 FAD-binding, type 2 (Domain)
 [1-223]  2.50000909916183e-63 SSF56176
SSF56176   FAD-binding_2
 [1-222]  PS51387
PS51387   FAD_PCMH
IPR016167 FAD-binding, type 2, subdomain 1 (Domain)
 [1-51]  3.60000000000001e-18 G3DSA:3.30.43.10
G3DSA:3.30.43.10   FAD-binding_2_sub1
IPR016169 CO dehydrogenase flavoprotein-like, FAD-binding, subdomain 2 (Domain)
 [61-113]  7.5e-34 G3DSA:3.30.465.10 [157-219]  7.5e-34 G3DSA:3.30.465.10
G3DSA:3.30.465.10   CO_DH_flavoprot_FAD-bd_sub2
SignalP
 [1-20]  0.261 Signal
Bacteria, Gram-negative   
TMHMM No significant hit