close all open/close all
Oxzol_00320 Oxzol_00320   last last

CDS information : Oxzol_00330


close this sectionLocation

Organism
StrainJA3453
Entry nameOxazolomycin
Contig
Start / Stop / Direction104,170 / 103,637 / - [in whole cluster]
104,170 / 103,637 / - [in contig]
Locationcomplement(103637..104170) [in whole cluster]
complement(103637..104170) [in contig]
TypeCDS
Length534 bp (177 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative oxidoreductase
Product (GenBank)oxidoreductase
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in oxazolomycin biosynthesis.
Note (GenBank)
  • ozm orf +5
Reference
ACC
Related Reference
ACC
P77165
PmId
[19368556] A periplasmic aldehyde oxidoreductase represents the first molybdopterin cytosine dinucleotide cofactor containing molybdo-flavoenzyme from Escherichia coli. (FEBS J. , 2009)
ACC
P72223
PmId
[8798497] Cloning, expression, and sequence analysis of the three genes encoding quinoline 2-oxidoreductase, a molybdenum-containing hydroxylase from Pseudomonas putida 86. (J Biol Chem. , 1996)

close this sectionSequence

selected fasta
>putative oxidoreductase [oxidoreductase]
MGADVFHSEVPLRVNGEARRPTVDHRSTLLDVLREQLGLTGAKKGCDHGQCGACTVLVDG
RRVNSCLLLAVALEGCEVTTVEGLAPGEGDDLHPLQRAFVDRDAFQCGYCTPGQICSAVG
AIEEAGAGRASHVTDPAANRGAPVELTRDEIRERLSGNICRCGAYPHIVEAVEDVTR
selected fasta
>putative oxidoreductase [oxidoreductase]
ATGGGAGCCGATGTGTTCCACTCGGAAGTGCCCCTGAGAGTGAACGGCGAAGCCCGCCGC
CCCACCGTCGACCACCGCTCGACGCTGCTGGACGTCCTGCGCGAGCAGCTCGGCCTGACC
GGCGCCAAGAAGGGCTGCGACCACGGCCAGTGCGGTGCCTGCACCGTCCTCGTGGACGGG
CGCCGCGTCAACAGCTGTCTGCTGCTCGCGGTCGCCCTGGAGGGGTGCGAGGTCACCACC
GTCGAGGGGCTCGCCCCCGGCGAGGGCGACGACCTGCACCCGCTCCAGCGGGCCTTCGTC
GACCGCGACGCCTTCCAGTGCGGTTACTGCACCCCGGGGCAGATCTGTTCCGCCGTCGGC
GCCATCGAAGAGGCCGGGGCGGGCCGCGCCTCCCACGTGACGGACCCCGCCGCCAACAGG
GGTGCGCCCGTGGAGCTGACCAGGGACGAGATCCGGGAGCGGCTCAGCGGCAACATCTGC
CGCTGCGGCGCCTATCCGCACATCGTCGAGGCCGTCGAGGACGTGACGCGATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001041 2Fe-2S ferredoxin-type domain (Domain)
 [7-85]  8.80000265836278e-28 SSF54292
SSF54292   Ferredoxin
 [8-84]  PS51085
PS51085   2FE2S_FER_2
 [14-64]  1.5e-07 PF00111
PF00111   Fer2
IPR002888 [2Fe-2S]-binding (Domain)
 [80-177]  9.5000102816722e-29 SSF47741
SSF47741   2Fe-2S_bind
 [82-176]  2.5e-28 G3DSA:1.10.150.120
G3DSA:1.10.150.120   2Fe-2S-bd
 [80-173]  6.3e-30 PF01799
PF01799   Fer2_2
IPR006058 2Fe-2S ferredoxin, iron-sulphur binding site (Binding_site)
 [46-54]  PS00197
PS00197   2FE2S_FER_1
IPR012675 Beta-grasp domain (Domain)
 [9-81]  8.89999999999994e-31 G3DSA:3.10.20.30
G3DSA:3.10.20.30   Ferredoxin_fold
SignalP No significant hit
TMHMM No significant hit
Oxzol_00320 Oxzol_00320   last last