close all open/close all
first first   Pact_00020 Pact_00020

CDS information : Pact_00010


close this sectionLocation

Organism
StrainATCC 27456 (=NBRC 13433)
Entry namePactamycin
Contig
Start / Stop / Direction2 / 1,882 / + [in whole cluster]
2 / 1,882 / + [in contig]
Location2..1882 [in whole cluster]
2..1882 [in contig]
TypeCDS
Length1,881 bp (626 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative helicase(fragment)
Product (GenBank)ATP-dependent RNA helicase
Geneorf1
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in pactamycin biosynthesis.
Note (GenBank)
  • orf1
Reference
ACC
PmId
[17827660] Cloning of the pactamycin biosynthetic gene cluster and characterization of a crucial glycosyltransferase prior to a unique cyclopentane ring formation. (J Antibiot (Tokyo). , 2007)
Related Reference
ACC
B7TWK5
PmId
[19670201] Deciphering pactamycin biosynthesis and engineered production of new pactamycin analogues. (Chembiochem. , 2009)
Family/Domain
FD
IPR011545, IPR001650

close this sectionSequence

selected fasta
>putative helicase(fragment) [ATP-dependent RNA helicase]
MLTPTRELAMQVSDALQPYGDVLGLKLKVVCGGTSMGNQIYALERGVDILVATPGRLRDI
IDRGAASLDRVQVAVLDEADQMADMGFLPEVTEILDLVPQGGQRLLFSATLENEIDTLVK
RYLVDPVTHEVDPSAGAVSTMTHHVLVVKPKDKAPVTAAIAARKGRTIIFVRTQLGADRV
AEQLRDSGVRADALHGGMTQGARTRTLADFKDGYVNVLVATDVAARGIHVDGIDLVLNVD
PAGDHKDYLHRSGRTARAGQSGTVVSLALPHQRRQIFRLMEDAGVDASRHIVGGAGAFDE
DVARITGARSLTEVQAESAANSAKQAEREVEQLTRELERVQRRATELREEADRLAARAAR
ERGEDPQAAVAPAEPAADGAEAPAAAPSVPEQTAAPVVENTVADEAPRRTGPERRDERGS
YERRDRGGDDRGGFGRDRDRRDDRPFNRDRRDDRGGFGRERRDGDRDRGFGRDRDRERPS
FRDRRDGDRDRRDGERGGSGGRSYERRDRDDRGFGRDRDDRGGFNRDRDRRDDRPFNRDR
RDDRGGFGRERREDRPGRPFERRDHAPRDHHRGGDRPFNRDRRDDRPFGRDRRDDRPARR
DDHRGGTTGSRSFDRRADKPRWKRNG
selected fasta
>putative helicase(fragment) [ATP-dependent RNA helicase]
ATCCTCACGCCCACCCGTGAGCTGGCCATGCAGGTGAGCGACGCGCTCCAGCCGTACGGC
GACGTCCTGGGCCTGAAGCTCAAGGTCGTCTGCGGCGGCACCTCGATGGGCAACCAGATC
TACGCCCTGGAGCGCGGGGTGGACATCCTCGTCGCGACCCCGGGCCGGCTGCGCGACATC
ATCGACCGCGGCGCCGCGTCGCTGGACCGCGTGCAGGTCGCGGTGCTGGACGAGGCGGAC
CAGATGGCCGACATGGGCTTCCTGCCCGAGGTCACCGAGATCCTCGACCTGGTGCCGCAG
GGCGGCCAGCGGCTGCTGTTCTCCGCGACGCTGGAGAACGAGATCGACACCCTGGTCAAG
CGCTACCTGGTCGACCCGGTGACGCACGAGGTGGACCCGTCCGCCGGCGCGGTCTCCACG
ATGACCCACCACGTGCTGGTGGTGAAGCCGAAGGACAAGGCCCCGGTCACCGCCGCCATC
GCCGCCCGCAAGGGCCGCACCATCATCTTCGTCCGCACCCAGCTGGGCGCGGACCGGGTG
GCCGAGCAGCTGCGGGACTCCGGGGTGCGGGCCGACGCCCTGCACGGCGGCATGACCCAG
GGCGCCCGGACCCGGACCCTCGCCGACTTCAAGGACGGTTACGTCAACGTCCTGGTCGCC
ACCGACGTCGCCGCGCGCGGTATCCACGTGGACGGCATCGACCTGGTGCTCAACGTGGAC
CCGGCCGGCGACCACAAGGACTACCTGCACCGCAGTGGGCGAACCGCCCGCGCCGGGCAG
AGCGGCACCGTGGTCTCGCTCGCCCTGCCGCACCAGCGGCGGCAGATCTTCCGGCTGATG
GAGGACGCGGGCGTGGACGCCTCGCGCCACATCGTCGGCGGGGCCGGCGCGTTCGACGAG
GACGTGGCCCGGATCACCGGCGCCCGGTCGCTCACCGAGGTGCAGGCCGAGTCGGCGGCG
AACTCCGCCAAGCAGGCCGAGCGCGAGGTGGAGCAGCTCACCCGCGAACTGGAGCGGGTG
CAGCGCCGCGCCACCGAGCTGCGCGAGGAGGCCGACCGGCTGGCCGCCCGGGCCGCGCGC
GAGCGTGGCGAGGACCCGCAGGCCGCCGTCGCCCCGGCCGAGCCGGCCGCCGACGGGGCC
GAGGCCCCGGCCGCCGCGCCGTCGGTGCCCGAGCAGACCGCCGCCCCCGTGGTGGAGAAC
ACCGTCGCGGACGAGGCGCCGCGCCGTACGGGCCCGGAGCGCCGGGACGAGCGGGGCTCC
TACGAGCGCCGTGACCGGGGCGGGGACGACCGGGGCGGCTTCGGCCGGGACCGGGACCGC
CGGGACGACCGTCCGTTCAACCGTGACCGCCGGGACGACCGGGGCGGCTTCGGCCGGGAG
CGCAGGGACGGCGACCGGGACCGTGGCTTCGGCCGTGACCGCGACCGCGAGCGTCCGTCG
TTCCGCGACCGCCGGGACGGCGACCGTGACCGCCGGGACGGCGAGCGCGGTGGTTCCGGT
GGCCGTTCGTACGAGCGCCGCGACCGCGACGACCGCGGCTTCGGCCGGGACCGCGACGAC
CGGGGCGGCTTCAACCGCGACCGGGACCGCCGGGACGACCGTCCGTTCAACCGTGACCGC
CGGGACGACCGCGGCGGCTTCGGCCGGGAGCGCCGGGAGGACCGCCCGGGCCGTCCGTTC
GAGCGCCGTGACCACGCCCCCCGGGACCACCACCGGGGCGGGGACCGTCCGTTCAACCGT
GACCGCCGCGACGACCGCCCGTTCGGCCGGGACCGCCGGGACGACCGTCCGGCCCGTCGT
GACGACCACCGGGGCGGCACCACCGGCAGCCGGTCCTTCGACCGCCGCGCCGACAAGCCC
CGCTGGAAGCGCAACGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001650 Helicase, C-terminal (Domain)
 [155-331]  19.522 PS51194
PS51194   HELICASE_CTER
 [178-259]  1.6e-28 SM00490
SM00490   helicase superfamily c-terminal domain
 [183-259]  7.9e-22 PF00271
PF00271   Helicase_C
IPR011545 DNA/RNA helicase, DEAD/DEAH box type, N-terminal (Domain)
 [2-116]  7.9e-24 PF00270
PF00270   DEAD
IPR014001 Helicase, superfamily 1/2, ATP-binding domain (Domain)
 [1-129]  22.355 PS51192
PS51192   HELICASE_ATP_BIND_1
 [1-144]  4.9e-08 SM00487
SM00487   DEAD-like helicases superfamily
SignalP No significant hit
TMHMM No significant hit
first first   Pact_00020 Pact_00020