close all open/close all

CDS information : Pact_00020


close this sectionLocation

Organism
StrainATCC 27456 (=NBRC 13433)
Entry namePactamycin
Contig
Start / Stop / Direction5,000 / 3,807 / - [in whole cluster]
5,000 / 3,807 / - [in contig]
Locationcomplement(3807..5000) [in whole cluster]
complement(3807..5000) [in contig]
TypeCDS
Length1,194 bp (397 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productputative cytochrome P450
Product (GenBank)cytochrome P450 monooxygenase
GenepctA
ptmY
Gene (GenBank)pctA
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[17827660] Cloning of the pactamycin biosynthetic gene cluster and characterization of a crucial glycosyltransferase prior to a unique cyclopentane ring formation. (J Antibiot (Tokyo). , 2007)
[19670201] Deciphering pactamycin biosynthesis and engineered production of new pactamycin analogues. (Chembiochem. , 2009)
[21513878] Biosynthetic studies and genetic engineering of pactamycin analogs with improved selectivity toward malarial parasites. (Chem Biol. , 2011)
Related Reference
ACC
O87605
NITE
Pikro_00170
PmId
[9770448] A gene cluster for macrolide antibiotic biosynthesis in Streptomyces venezuelae: architecture of metabolic diversity. (Proc Natl Acad Sci U S A. , 1998)
[9778370] Characterization of the macrolide P-450 hydroxylase from Streptomyces venezuelae which converts narbomycin to picromycin. (Biochemistry. , 1998)
[9831532] Hydroxylation of macrolactones YC-17 and narbomycin is mediated by the pikC-encoded cytochrome P450 in Streptomyces venezuelae. (Chem Biol. , 1998)

close this sectionSequence

selected fasta
>putative cytochrome P450 [cytochrome P450 monooxygenase]
MHTPTLDDLARPGTGLSDNPYPVLARLRARGPVHRLRTGDTQEVWVIVGHDEARAALADP
RLRNDARHADGADDAGHAVGRNMLQVDPPHHTRLRRLVAAQFAARRIEALRPRVRAITDD
LLEKMVPLGRADLVERFAQPLPLAVICELLGVPAADRKAFGEWSADIVTPGSPAAADSAA
TMTGYLTGLVEDKRRDGGDDLLSALVAARDGGDRLTPEETIGMAFLLLVAGYETTVNLIS
SGVCALLLRPEQLAALRDDPSLLDGAVEEMLRHESPLGTSAYRYTTEPVEIAGTRIPAGQ
RVLVVLNAADRDPDRFPDPDRFDIRRDARGHLAFGHGLHHCLGAPLARLEATVALRGLLE
RAPGLRLAADPATLTWRSGLMRGLHRLPVTFGPVPEP
selected fasta
>putative cytochrome P450 [cytochrome P450 monooxygenase]
ATGCACACCCCCACCCTCGACGATCTGGCGCGCCCCGGCACCGGGCTGTCCGACAACCCC
TATCCGGTCCTCGCGCGGCTGCGCGCCCGGGGACCGGTCCACCGCCTGCGCACCGGCGAC
ACCCAGGAGGTCTGGGTGATCGTCGGACACGACGAGGCCAGGGCCGCGCTCGCCGACCCC
CGGCTGCGCAACGACGCCCGTCACGCCGACGGCGCGGACGACGCCGGCCACGCGGTCGGC
CGGAACATGCTCCAGGTGGACCCGCCCCACCACACCCGGCTGCGGCGGCTGGTCGCCGCA
CAGTTCGCCGCCCGGCGCATCGAGGCGCTGCGGCCCCGGGTGCGGGCGATCACCGACGAC
CTGCTGGAGAAGATGGTGCCGCTGGGCCGGGCCGATCTGGTGGAACGTTTCGCCCAGCCG
CTGCCGCTGGCCGTCATCTGCGAGCTGCTCGGCGTCCCGGCGGCCGACCGGAAGGCGTTC
GGCGAATGGTCGGCGGACATCGTCACCCCGGGCAGCCCGGCCGCCGCCGACTCCGCCGCG
ACGATGACCGGCTACCTCACCGGGCTGGTCGAGGACAAGCGCCGCGACGGCGGGGACGAC
CTGCTCAGCGCCCTGGTCGCGGCCCGTGACGGCGGTGACCGGCTCACCCCGGAGGAGACG
ATCGGCATGGCGTTCCTGCTGCTCGTCGCCGGGTACGAGACCACCGTCAACCTGATCTCC
AGCGGCGTGTGCGCGCTGCTGCTGCGGCCGGAGCAGCTGGCCGCGCTGCGGGACGACCCG
TCCCTGCTGGACGGCGCGGTGGAGGAGATGCTCCGGCACGAGAGCCCGCTGGGCACCTCC
GCCTACCGCTACACCACCGAACCGGTGGAGATCGCGGGCACCCGCATCCCGGCCGGGCAG
CGGGTGCTGGTGGTGCTGAACGCCGCCGACCGCGACCCGGACCGCTTCCCGGACCCGGAC
CGCTTCGACATCCGGCGCGACGCCCGCGGCCACCTGGCGTTCGGCCACGGCCTCCACCAC
TGCCTGGGCGCGCCGCTCGCCCGGCTGGAGGCCACGGTGGCGCTGCGCGGCCTGCTGGAA
CGCGCTCCCGGCCTCCGCCTCGCCGCGGACCCCGCCACCCTCACCTGGCGCTCCGGCCTG
ATGCGCGGCCTGCACCGCCTCCCGGTCACCTTCGGCCCGGTGCCCGAGCCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001128 Cytochrome P450 (Family)
 [15-393]  1.5e-117 G3DSA:1.10.630.10
G3DSA:1.10.630.10   Cyt_P450
 [230-247]  6.5000009155689e-05 PR00385 [265-276]  6.5000009155689e-05 PR00385 [332-341]  6.5000009155689e-05 PR00385 [341-352]  6.5000009155689e-05 PR00385
PR00385   P450
 [193-361]  4.80000000000001e-24 PF00067
PF00067   p450
 [18-393]  4.40002866058555e-101 SSF48264
SSF48264   Cytochrome_P450
IPR002397 Cytochrome P450, B-class (Family)
 [86-97]  1.40000506907309e-60 PR00359 [132-148]  1.40000506907309e-60 PR00359 [149-164]  1.40000506907309e-60 PR00359 [184-206]  1.40000506907309e-60 PR00359 [265-276]  1.40000506907309e-60 PR00359 [283-310]  1.40000506907309e-60 PR00359 [311-326]  1.40000506907309e-60 PR00359 [332-341]  1.40000506907309e-60 PR00359 [341-352]  1.40000506907309e-60 PR00359
PR00359   BP450
IPR017972 Cytochrome P450, conserved site (Conserved_site)
 [334-343]  PS00086
PS00086   CYTOCHROME_P450
SignalP
 [1-31]  0.095 Signal
Bacteria, Gram-negative   
TMHMM No significant hit