close all open/close all

CDS information : Pact_00030


close this sectionLocation

Organism
StrainATCC 27456 (=NBRC 13433)
Entry namePactamycin
Contig
Start / Stop / Direction5,542 / 5,054 / - [in whole cluster]
5,542 / 5,054 / - [in contig]
Locationcomplement(5054..5542) [in whole cluster]
complement(5054..5542) [in contig]
TypeCDS
Length489 bp (162 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productputative glutathione peroxidase
Product (GenBank)glutathione peroxidase
GenepctB
ptmZ
Gene (GenBank)pctB
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[17827660] Cloning of the pactamycin biosynthetic gene cluster and characterization of a crucial glycosyltransferase prior to a unique cyclopentane ring formation. (J Antibiot (Tokyo). , 2007)
[19670201] Deciphering pactamycin biosynthesis and engineered production of new pactamycin analogues. (Chembiochem. , 2009)
Family/Domain
FD
IPR000889

close this sectionSequence

selected fasta
>putative glutathione peroxidase [glutathione peroxidase]
MSLYDIPVRTLAGEPHDLSRYRGKALLVVNVASQCGRTRQYAALEELHRRYGPRGFSVLG
FPCNQFGEQEPGGPEEIERFCTTTYGVTFPLFEKVEVNGPGRHPLYALLTAAPDDRGVAG
DIEWNFEKFLISPEGRVAHRIASRTRPDDPDVVARIEALLPA
selected fasta
>putative glutathione peroxidase [glutathione peroxidase]
ATGTCCCTGTACGACATTCCCGTCCGCACGCTCGCCGGCGAGCCCCACGACCTCTCCCGC
TACCGGGGGAAGGCGCTGCTCGTGGTCAACGTCGCCTCGCAGTGCGGCCGGACCCGCCAG
TACGCCGCCCTGGAGGAGCTGCACCGCCGGTACGGCCCGCGCGGCTTCTCGGTCCTGGGC
TTCCCCTGCAACCAGTTCGGGGAGCAGGAGCCGGGCGGCCCGGAGGAGATCGAACGGTTC
TGCACCACCACCTACGGCGTCACCTTCCCGCTGTTCGAGAAGGTGGAGGTCAATGGCCCC
GGCCGGCACCCGCTCTACGCGCTGCTGACCGCCGCCCCGGACGACCGGGGGGTGGCCGGG
GACATCGAGTGGAACTTCGAGAAGTTCCTCATCTCCCCCGAGGGCCGGGTGGCCCACCGC
ATCGCCTCCCGCACCAGGCCCGACGACCCGGACGTCGTCGCCAGGATCGAGGCGCTGCTG
CCGGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000889 Glutathione peroxidase (Family)
 [59-66]  PS00763
PS00763   GLUTATHIONE_PEROXID_2
 [3-109]  1.70000000000001e-41 PF00255
PF00255   GSHPx
 [23-38]  PS00460
PS00460   GLUTATHIONE_PEROXID_1
 [1-162]  PS51355
PS51355   GLUTATHIONE_PEROXID_3
 [21-38]  5.59999989417023e-21 PR01011 [56-72]  5.59999989417023e-21 PR01011 [122-131]  5.59999989417023e-21 PR01011
PR01011   GLUTPROXDASE
 [1-162]  7.19996395543973e-70 PIRSF000303
PIRSF000303   Glutathion_perox
IPR012336 Thioredoxin-like fold (Domain)
 [1-160]  1.40000000000001e-61 G3DSA:3.40.30.10
G3DSA:3.40.30.10   Thioredoxin_fold
 [1-161]  4.69998262513195e-57 SSF52833
SSF52833   Thiordxn-like_fd
SignalP No significant hit
TMHMM No significant hit