close all open/close all

CDS information : Pact_00040


close this sectionLocation

Organism
StrainATCC 27456 (=NBRC 13433)
Entry namePactamycin
Contig
Start / Stop / Direction6,934 / 5,759 / - [in whole cluster]
6,934 / 5,759 / - [in contig]
Locationcomplement(5759..6934) [in whole cluster]
complement(5759..6934) [in contig]
TypeCDS
Length1,176 bp (391 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Productputative aminotransferase
Product (GenBank)aminotransferase
GenepctC
ptmA
Gene (GenBank)pctC
EC number2.6.1.-
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[17827660] Cloning of the pactamycin biosynthetic gene cluster and characterization of a crucial glycosyltransferase prior to a unique cyclopentane ring formation. (J Antibiot (Tokyo). , 2007)
[23744829] A single PLP-dependent enzyme PctV catalyzes the transformation of 3-dehydroshikimate into 3-aminobenzoate in the biosynthesis of pactamycin. (Chembiochem. , 2013)
[19670201] Deciphering pactamycin biosynthesis and engineered production of new pactamycin analogues. (Chembiochem. , 2009)
Related Reference
ACC
Q53U20
PmId
[16506694] Biosynthesis of 2-deoxystreptamine by three crucial enzymes in Streptomyces fradiae NBRC 12773. (J Antibiot (Tokyo). , 2005)

close this sectionSequence

selected fasta
>putative aminotransferase [aminotransferase]
MRYEPWRALALWGEEEAAAALEVVRSRSLFRYYGPDLGHRTDAFERAFAELAGVPHTVAV
SSGTAALTAAMVGLGIPEGAEVIVPAVTFVASVGAVVAARGVPVFAEVDDTLTLDPAKLE
ELVTERTWGVMPVHLANVAADMDPILEVARRHGLRVIEDAAQAAGVSYRGRPVGGIGDAG
AFSFQLDKNITAGEGGAVTVTDADVYDRVARYQDQGGQFTTSKGATRGTADHPPFIGANL
RMTELTAAILSVQLPRLVPLCKRLRDVARQVRAETAGLPLQWRRLPDEEGSGGDLTFFTE
SRLEARRVVGALTAAGIPAHTMYQGQTVTSNRAVREGRTPWGVAWERPPRFRASEGYLGR
SVTVGLGAAMTDEDVDTIVATLRSAWADAAG
selected fasta
>putative aminotransferase [aminotransferase]
ATGCGGTACGAGCCCTGGCGGGCCCTGGCACTGTGGGGGGAGGAGGAGGCCGCCGCGGCG
CTGGAGGTCGTCAGGTCCCGCTCGCTGTTCCGGTACTACGGGCCGGACCTGGGCCACCGC
ACCGACGCCTTCGAGCGCGCCTTCGCCGAGCTGGCCGGGGTCCCGCACACCGTCGCGGTC
TCCTCCGGGACGGCCGCGCTCACCGCCGCCATGGTGGGCCTGGGCATCCCCGAGGGGGCC
GAGGTCATCGTGCCCGCGGTGACCTTCGTGGCCAGCGTCGGCGCGGTCGTCGCCGCCCGC
GGCGTGCCGGTCTTCGCCGAGGTGGACGACACCCTCACCCTGGACCCGGCGAAGCTGGAG
GAGCTGGTCACCGAGCGCACCTGGGGCGTGATGCCGGTCCACCTGGCCAACGTGGCCGCC
GACATGGACCCGATCCTGGAGGTGGCGCGCCGGCACGGCCTGCGGGTGATCGAGGACGCC
GCCCAGGCCGCCGGGGTGTCCTACCGCGGCCGGCCGGTGGGCGGCATCGGCGACGCCGGG
GCGTTCAGCTTCCAGCTCGACAAGAACATCACCGCCGGCGAGGGCGGCGCGGTCACCGTC
ACCGACGCCGACGTCTACGACCGGGTGGCCCGCTACCAGGACCAGGGCGGCCAGTTCACC
ACCTCCAAGGGCGCCACCCGGGGCACCGCCGACCACCCGCCGTTCATCGGCGCCAACCTG
CGGATGACCGAACTGACCGCGGCCATCCTCTCGGTGCAGCTGCCCCGGCTGGTGCCGCTG
TGCAAGCGGCTGCGCGACGTGGCCCGCCAGGTGCGCGCCGAGACCGCCGGGCTGCCCCTC
CAGTGGCGGCGGCTGCCCGACGAGGAGGGCTCCGGCGGCGACCTCACCTTCTTCACCGAG
TCCCGGCTGGAGGCCCGCCGCGTGGTCGGCGCCCTCACCGCCGCCGGCATCCCGGCGCAC
ACCATGTACCAGGGGCAGACCGTCACCTCCAACCGCGCGGTGCGGGAGGGACGCACCCCC
TGGGGCGTGGCCTGGGAGCGCCCGCCGCGGTTCCGGGCCAGCGAGGGCTACCTGGGCCGC
TCGGTCACCGTCGGGCTGGGCGCCGCGATGACCGACGAGGACGTGGACACCATCGTCGCC
ACCCTCCGCTCGGCCTGGGCGGACGCCGCCGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000653 DegT/DnrJ/EryC1/StrS aminotransferase (Family)
 [1-390]  2.29998420488559e-70 PIRSF000390
PIRSF000390   PLP_StrS
 [13-383]  3.60000000000002e-90 PF01041
PF01041   DegT_DnrJ_EryC1
IPR015421 Pyridoxal phosphate-dependent transferase, major region, subdomain 1 (Domain)
 [13-255]  2.39999999999997e-68 G3DSA:3.40.640.10
G3DSA:3.40.640.10   PyrdxlP-dep_Trfase_major_sub1
IPR015424 Pyridoxal phosphate-dependent transferase, major domain (Domain)
 [2-390]  1.09999184471405e-75 SSF53383
SSF53383   PyrdxlP-dep_Trfase_major
SignalP No significant hit
TMHMM No significant hit