close all open/close all

CDS information : Pact_00050


close this sectionLocation

Organism
StrainATCC 27456 (=NBRC 13433)
Entry namePactamycin
Contig
Start / Stop / Direction8,661 / 6,949 / - [in whole cluster]
8,661 / 6,949 / - [in contig]
Locationcomplement(6949..8661) [in whole cluster]
complement(6949..8661) [in contig]
TypeCDS
Length1,713 bp (570 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Productputative carbamoyltransferase
Product (GenBank)carbamoyltransferase
GenepctD
ptmB
Gene (GenBank)pctD
EC number2.1.3.-
Keyword
  • urea moiety
Note
Note (GenBank)
Reference
ACC
PmId
[17827660] Cloning of the pactamycin biosynthetic gene cluster and characterization of a crucial glycosyltransferase prior to a unique cyclopentane ring formation. (J Antibiot (Tokyo). , 2007)
[19670201] Deciphering pactamycin biosynthesis and engineered production of new pactamycin analogues. (Chembiochem. , 2009)
[21513878] Biosynthetic studies and genetic engineering of pactamycin analogs with improved selectivity toward malarial parasites. (Chem Biol. , 2011)
Related Reference
ACC
Q8KUG9
NITE
Ansam_00230
PmId
[14624546] The post-polyketide synthase modification steps in the biosynthesis of the antitumor agent ansamitocin by Actinosynnema pretiosum. (J Am Chem Soc. , 2003)
[22195559] Dual carbamoylations on the polyketide and glycosyl moiety by asm21 result in extended ansamitocin biosynthesis. (Chem Biol. , 2011)
Family/Domain
FD
IPR003696

close this sectionSequence

selected fasta
>putative carbamoyltransferase [carbamoyltransferase]
MLALGLGGSNHDFSACLVENGEIAVGIEEERLARRKYAVNVNSLANQGWRYCLETRGVRL
ADVEAIVADDTLLPSCYFPFRSRTTLIRHHMAHAASAFYPSPYDEAAVLVVDGAGSLFEG
RGIETMTLSVGHGVEIDEISKVYGTNWSTDGLRSDRVYQAGDSDHSLGFMYKAVSRAVGF
TLYEEGSWYLTEDGKTMGLAPYGTDRYREEFRRHLELLPEGRFALHLKDGGLLAFVEHAL
DGLEGEERFARGADLAWAAQDLLETAVLHAARWLHAETGLSRLCLAGGVVLNSVANGKIL
RETPFTEVFAQPAAGDNGCAVGCAYYGYHVLGERPRTRGPAASGPGSRPQIHTYLGRSYP
TERIQAALDASGLPYRRVENPARLAAELLPKGKLIGWYTGGSEFGPRALGHRSILADPRR
AEMKDILNSKVKHREWFRPFAPAVPAHRAAEYFDLDTESPFMLIVAPVREDKREEVPAIT
HVDGTARVQTLTPEANGPFYELVERFGELTGVPVVLNTSFNDRGEPIVETAEQALAFFGP
SQLDYLFLEDFLVGHSVTDLDTATETEETE
selected fasta
>putative carbamoyltransferase [carbamoyltransferase]
ATGCTGGCTCTGGGTCTCGGCGGTTCGAACCATGACTTTTCGGCCTGTCTTGTCGAAAAC
GGCGAAATCGCTGTCGGTATCGAGGAAGAGCGCCTGGCTCGCCGCAAGTACGCAGTCAAT
GTGAACTCGCTGGCCAATCAGGGCTGGCGGTACTGCCTGGAAACGCGCGGGGTACGGCTC
GCCGACGTGGAAGCGATCGTCGCGGACGACACCCTGCTGCCCAGTTGCTACTTCCCGTTC
CGCAGCCGCACCACGCTGATCAGGCACCACATGGCCCACGCGGCGAGCGCCTTCTACCCC
TCGCCGTACGACGAGGCCGCGGTGCTCGTGGTGGACGGCGCCGGCAGCCTCTTCGAGGGC
CGGGGCATCGAGACGATGACCCTGTCGGTGGGCCACGGCGTGGAGATCGACGAGATCTCC
AAGGTGTACGGGACCAACTGGAGCACCGACGGCCTGCGGTCGGACCGGGTCTACCAGGCC
GGCGACAGCGACCACTCGCTGGGCTTCATGTACAAGGCGGTCAGCCGCGCCGTCGGCTTC
ACCCTCTACGAGGAGGGCAGCTGGTACCTGACCGAGGACGGCAAGACGATGGGCCTGGCG
CCCTACGGCACCGACCGCTACCGGGAGGAGTTCCGGCGGCACCTGGAGCTGCTGCCGGAG
GGCCGGTTCGCGCTGCACCTCAAGGACGGCGGGCTGCTCGCCTTCGTGGAGCACGCGCTG
GACGGGCTGGAGGGCGAGGAGCGCTTCGCCCGCGGCGCCGACCTGGCCTGGGCCGCCCAG
GACCTGCTGGAGACCGCGGTGCTGCACGCCGCCCGCTGGCTGCACGCGGAGACCGGGCTG
TCCCGGCTCTGCCTGGCCGGCGGGGTGGTGCTCAACTCGGTCGCCAACGGCAAGATCCTC
CGTGAGACCCCGTTCACCGAGGTCTTCGCCCAGCCCGCGGCGGGCGACAACGGCTGCGCG
GTCGGCTGCGCGTACTACGGCTACCACGTGCTCGGCGAGCGGCCCCGGACCCGCGGCCCG
GCGGCGTCCGGCCCCGGCTCCCGGCCGCAGATCCACACCTACCTCGGCCGCAGCTACCCC
ACCGAGCGGATCCAGGCCGCGCTGGACGCCTCCGGGCTGCCCTACCGGCGGGTGGAGAAC
CCCGCCCGGCTCGCCGCCGAACTGCTGCCCAAGGGCAAGCTCATCGGCTGGTACACCGGC
GGCTCGGAGTTCGGGCCCCGGGCGCTGGGGCACCGCAGCATCCTGGCCGACCCGCGCCGC
GCGGAGATGAAGGACATCCTCAACAGCAAGGTCAAGCACCGCGAGTGGTTCCGGCCGTTC
GCCCCGGCGGTGCCGGCCCACCGGGCCGCCGAGTACTTCGACCTCGACACCGAGTCGCCG
TTCATGCTGATCGTCGCGCCGGTCCGGGAGGACAAGCGCGAGGAGGTCCCGGCGATCACC
CACGTCGACGGCACCGCGCGGGTGCAGACGCTCACCCCGGAGGCGAACGGGCCCTTCTAC
GAACTGGTGGAACGGTTCGGCGAGCTCACCGGCGTACCCGTGGTGCTCAACACCTCCTTC
AACGACCGGGGCGAGCCGATCGTGGAGACCGCCGAGCAGGCGCTCGCCTTCTTCGGGCCG
AGCCAGCTCGACTACCTCTTCCTGGAGGACTTCCTGGTGGGCCACAGCGTGACCGATCTC
GACACGGCGACGGAGACGGAGGAGACCGAGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003696 Carbamoyltransferase (Family)
 [95-489]  5.50000000000008e-82 PF02543
PF02543   CmcH_NodU
SignalP No significant hit
TMHMM No significant hit