close all open/close all

CDS information : Pact_00060


close this sectionLocation

Organism
StrainATCC 27456 (=NBRC 13433)
Entry namePactamycin
Contig
Start / Stop / Direction8,934 / 10,037 / + [in whole cluster]
8,934 / 10,037 / + [in contig]
Location8934..10037 [in whole cluster]
8934..10037 [in contig]
TypeCDS
Length1,104 bp (367 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.3 uncharacterized protein (biosynthesis involved)
Producthypothetical protein
Product (GenBank)Fe-S Radical SAM oxidoreductase
GenepctE
ptmC
Gene (GenBank)pctE
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[17827660] Cloning of the pactamycin biosynthetic gene cluster and characterization of a crucial glycosyltransferase prior to a unique cyclopentane ring formation. (J Antibiot (Tokyo). , 2007)
[19670201] Deciphering pactamycin biosynthesis and engineered production of new pactamycin analogues. (Chembiochem. , 2009)

close this sectionSequence

selected fasta
>hypothetical protein [Fe-S Radical SAM oxidoreductase]
MFAHRDGQNRLKLLMNDMVIEEQLCQMRCSYCLTEDFNLLMNVPDARLRLTTDRRADWHE
ILDAYHRTVDSPIMRLSGGEFFWLKGSTEFVEECSAKYEVVQVITNGVFLTPPRLEALAA
LGNVQLCLSLDGHTLEMNGHRFPPKQHRLFDVIMGHLDHAVELGIPIEIQSVLSDLNVTR
QADFAEFLLERYGSGVMLYFFPVRGETRTTHAPALGDHFAELLERYDELSAVLPPRAFVA
HIANQLSTGVRTLRCYATATMVQLFGQGDVSCCPYAWLKPMGNIKNEPELIHEQFGKHQH
YEMFMQPRPRFPYCKSCTGPIDVVNLYLFGGITEEEIARCAPYAGPRALERLRELKSAFD
PMFQAAE
selected fasta
>hypothetical protein [Fe-S Radical SAM oxidoreductase]
ATGTTCGCACATCGCGACGGACAGAACCGCCTCAAACTCCTGATGAACGACATGGTCATC
GAGGAGCAGTTGTGCCAGATGCGCTGCTCCTACTGCCTCACCGAGGACTTCAACCTCCTC
ATGAACGTCCCGGACGCCCGGCTGCGGCTGACCACCGACCGGCGGGCGGACTGGCACGAG
ATACTCGACGCCTACCACCGCACCGTGGACAGCCCCATCATGCGGCTGAGCGGCGGTGAG
TTCTTCTGGCTGAAGGGCTCCACCGAGTTCGTCGAGGAGTGCAGTGCCAAGTACGAGGTG
GTGCAGGTCATCACCAACGGGGTCTTCCTGACCCCGCCGCGGCTGGAGGCGCTGGCCGCG
CTCGGCAACGTCCAGCTCTGCCTGTCGCTGGACGGCCACACGCTGGAGATGAACGGGCAC
CGGTTCCCGCCCAAGCAGCACCGGCTGTTCGACGTCATCATGGGCCACCTGGACCACGCG
GTGGAGCTGGGCATCCCGATCGAGATCCAGTCGGTGCTCAGTGACCTGAACGTCACCCGG
CAGGCGGACTTCGCCGAGTTCCTGCTGGAACGGTACGGCAGCGGCGTGATGCTGTACTTC
TTCCCGGTCCGCGGCGAGACCCGCACCACCCACGCGCCGGCGCTCGGCGATCACTTCGCC
GAGCTGCTGGAACGCTACGACGAGCTGTCGGCCGTGCTGCCGCCGCGCGCCTTCGTGGCG
CACATCGCGAACCAGCTGAGCACCGGGGTCCGTACGCTGCGCTGCTACGCGACGGCCACC
ATGGTGCAGCTTTTCGGCCAGGGCGACGTCTCCTGCTGCCCCTATGCCTGGCTCAAGCCC
ATGGGGAATATCAAGAACGAGCCCGAGCTGATTCACGAGCAGTTCGGCAAGCACCAGCAC
TACGAAATGTTCATGCAGCCGCGGCCCCGCTTCCCGTACTGCAAGAGCTGCACCGGGCCG
ATCGACGTGGTGAATCTCTACCTGTTCGGCGGCATCACCGAGGAAGAAATCGCGCGCTGT
GCGCCGTACGCCGGGCCCCGGGCGCTGGAGCGTCTGCGGGAGCTGAAGTCGGCATTCGAC
CCGATGTTCCAGGCGGCCGAATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
No significant hit
SignalP No significant hit
TMHMM No significant hit