close all open/close all

CDS information : Pact_00070


close this sectionLocation

Organism
StrainATCC 27456 (=NBRC 13433)
Entry namePactamycin
Contig
Start / Stop / Direction10,103 / 11,179 / + [in whole cluster]
10,103 / 11,179 / + [in contig]
Location10103..11179 [in whole cluster]
10103..11179 [in contig]
TypeCDS
Length1,077 bp (358 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.2 modification methylation
ProductN,N-dimethyltransferase
Product (GenBank)methyltransferase
GenepctF
ptmD
Gene (GenBank)pctF
EC number2.1.1.-
Keyword
  • urea moiety
Note
Note (GenBank)
Reference
ACC
PmId
[17827660] Cloning of the pactamycin biosynthetic gene cluster and characterization of a crucial glycosyltransferase prior to a unique cyclopentane ring formation. (J Antibiot (Tokyo). , 2007)
[19670201] Deciphering pactamycin biosynthesis and engineered production of new pactamycin analogues. (Chembiochem. , 2009)
[21513878] Biosynthetic studies and genetic engineering of pactamycin analogs with improved selectivity toward malarial parasites. (Chem Biol. , 2011)

close this sectionSequence

selected fasta
>N,N-dimethyltransferase [methyltransferase]
MISVDGISADDFAGAGLSRLLRLPQHDLLTLAGDWLGELAPWRNTETLAAISTTLSAEAQ
LAALFIFGEPVAEAEARDRLPGPLLDLLLRTGALAADSGKLSARYCLVRGDGMSLLAAWR
AAGRDVGGYAPWVGTDSMTLSRLVAARRDVRTALDLGCGTGILGLSAARNGADVVSVDVN
PECTAAATVNAHINGLGERLTAVEGDIMSLDLDRRFDLVISNPPCLPLRRGSLGWLAGEA
GLDGLEFFWELLRRVPGLLTGEGEALLQAAAYGDERGPFFVEELEAELRRLKVSGRLLLR
PSTPPRWPAFAPRDEEGQLTGPLGDEVREYVNRIGATHYYGFVLSVRAGEGLDVGRFS
selected fasta
>N,N-dimethyltransferase [methyltransferase]
ATGATATCCGTGGACGGGATTTCGGCCGACGATTTCGCGGGTGCCGGACTGAGCAGGCTG
CTCAGGCTGCCGCAGCACGACCTGCTCACCCTCGCCGGTGACTGGCTCGGCGAACTGGCG
CCCTGGCGGAACACCGAGACCCTGGCGGCGATCTCCACCACGCTGTCCGCCGAGGCCCAG
TTGGCCGCCCTGTTCATCTTCGGCGAGCCGGTCGCCGAGGCCGAGGCCCGCGACCGGCTC
CCCGGCCCGCTGCTCGACCTGCTGCTGCGCACCGGGGCGCTGGCCGCGGACTCCGGGAAG
CTGTCGGCCCGGTACTGCCTGGTCCGAGGCGACGGGATGTCGCTGCTCGCCGCGTGGCGG
GCGGCCGGCCGCGACGTGGGCGGCTACGCGCCGTGGGTCGGCACCGACTCCATGACGCTC
TCCCGGCTGGTCGCCGCCCGCCGGGACGTGCGCACCGCGCTGGACCTGGGGTGCGGCACC
GGCATCCTGGGCCTGTCGGCGGCCCGCAACGGGGCCGACGTGGTGTCGGTGGACGTCAAC
CCCGAGTGCACCGCCGCCGCCACGGTCAACGCCCACATCAACGGACTGGGCGAGCGGCTC
ACCGCGGTCGAGGGCGACATCATGTCCCTGGACCTGGACCGCCGGTTCGACCTGGTGATC
TCCAACCCGCCCTGCCTGCCGCTGCGCCGCGGGTCGCTGGGCTGGCTGGCCGGCGAGGCG
GGGCTGGACGGGCTGGAGTTCTTCTGGGAGCTGCTGCGCCGGGTGCCCGGGCTGCTGACC
GGCGAGGGTGAGGCGCTGCTGCAGGCCGCCGCCTACGGTGACGAGCGCGGCCCGTTCTTC
GTCGAGGAGCTGGAGGCGGAGCTGCGGCGGCTGAAGGTGTCCGGGCGGCTGCTGCTGCGC
CCCTCCACGCCGCCGCGCTGGCCGGCCTTCGCGCCCCGCGACGAGGAGGGGCAGCTGACC
GGTCCGCTCGGCGACGAGGTCCGCGAGTACGTCAACCGGATCGGTGCCACGCACTACTAC
GGGTTCGTGCTCTCCGTGCGGGCCGGTGAGGGCCTGGACGTCGGCCGGTTCAGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
No significant hit
SignalP No significant hit
TMHMM No significant hit