close all open/close all

CDS information : Pact_00080


close this sectionLocation

Organism
StrainATCC 27456 (=NBRC 13433)
Entry namePactamycin
Contig
Start / Stop / Direction11,708 / 11,172 / - [in whole cluster]
11,708 / 11,172 / - [in contig]
Locationcomplement(11172..11708) [in whole cluster]
complement(11172..11708) [in contig]
TypeCDS
Length537 bp (178 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)hypothetical protein
GenepctG
ptmE
Gene (GenBank)pctG
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[17827660] Cloning of the pactamycin biosynthetic gene cluster and characterization of a crucial glycosyltransferase prior to a unique cyclopentane ring formation. (J Antibiot (Tokyo). , 2007)
[19670201] Deciphering pactamycin biosynthesis and engineered production of new pactamycin analogues. (Chembiochem. , 2009)

close this sectionSequence

selected fasta
>hypothetical protein [hypothetical protein]
MRVVVITGAPGVGKTRLGHQLVARYGVPAAAVDCDPVVYPWDGNESLYALMAATVRASLP
VYRDWGARVVVLSGVVLAGRAYEPLHRVFADLGADPVYYGLRAAPEALAARISGDPGGEH
FVEGRLAERHLDEEVPGVPGIRLIDTTELTLAAATDAVAAAEFADLGPGWLPDPRVIS
selected fasta
>hypothetical protein [hypothetical protein]
ATGCGCGTGGTGGTGATCACCGGTGCCCCGGGCGTGGGCAAGACCCGCCTGGGGCACCAG
CTGGTGGCCCGGTACGGCGTGCCGGCCGCCGCGGTGGACTGCGACCCGGTCGTCTACCCG
TGGGACGGCAACGAGAGCCTGTACGCCCTGATGGCCGCGACGGTCCGGGCGTCCCTCCCG
GTCTACCGGGACTGGGGCGCCCGGGTGGTGGTGCTCAGCGGAGTGGTCCTGGCCGGCCGC
GCCTACGAGCCCCTCCACCGGGTCTTCGCCGACCTGGGCGCCGACCCGGTCTACTACGGC
CTGCGCGCCGCCCCGGAGGCGCTCGCCGCCCGGATCAGCGGCGATCCGGGCGGCGAGCAC
TTCGTCGAGGGCCGGCTCGCCGAGCGCCACCTCGACGAGGAGGTGCCCGGCGTGCCCGGC
ATCCGGCTCATCGACACCACCGAGCTGACGCTGGCGGCGGCGACCGACGCGGTCGCCGCC
GCCGAGTTCGCCGATCTGGGGCCCGGCTGGCTGCCGGACCCCCGGGTGATCAGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
No significant hit
SignalP No significant hit
TMHMM No significant hit