close all open/close all

CDS information : Pact_00090


close this sectionLocation

Organism
StrainATCC 27456 (=NBRC 13433)
Entry namePactamycin
Contig
Start / Stop / Direction12,358 / 11,708 / - [in whole cluster]
12,358 / 11,708 / - [in contig]
Locationcomplement(11708..12358) [in whole cluster]
complement(11708..12358) [in contig]
TypeCDS
Length651 bp (216 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)hypothetical protein
GenepctH
ptmF
Gene (GenBank)pctH
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[17827660] Cloning of the pactamycin biosynthetic gene cluster and characterization of a crucial glycosyltransferase prior to a unique cyclopentane ring formation. (J Antibiot (Tokyo). , 2007)
[19670201] Deciphering pactamycin biosynthesis and engineered production of new pactamycin analogues. (Chembiochem. , 2009)

close this sectionSequence

selected fasta
>hypothetical protein [hypothetical protein]
MKGFPVYVLAQSLTPEDLAILADACAEVGLTLHHSEPGSAPPDPSDALLVSFHRVGADPA
GGPTAQELKEIGGYAVAVLDGIAAGAVLAAVTNGYSFTLASPLRRPRLVETLTYLKHITP
PENTQVLTLDGAGSLHSPSKSTPVTDAEAGLLRMLAARPGQIVSREDLTEATGGEDVSRV
TSVLKQKLLDIDSGAKLLKIPHLGFRLVGTVRQDAR
selected fasta
>hypothetical protein [hypothetical protein]
GTGAAGGGGTTCCCCGTGTACGTACTGGCCCAGTCCCTGACCCCCGAGGACCTCGCAATC
CTGGCCGACGCCTGCGCCGAAGTGGGGCTGACCCTGCACCACTCGGAGCCCGGGTCCGCT
CCCCCGGACCCGTCCGACGCCCTGCTGGTCTCCTTCCACCGGGTCGGGGCCGACCCGGCC
GGCGGTCCGACGGCCCAGGAGCTGAAGGAGATCGGCGGCTACGCCGTCGCGGTGCTGGAC
GGCATAGCCGCCGGCGCCGTGCTCGCGGCGGTCACGAACGGCTACAGCTTCACCCTGGCC
AGCCCGCTGCGCCGGCCGAGGCTGGTGGAGACCCTCACCTACCTCAAGCACATCACCCCG
CCGGAGAACACCCAGGTGCTCACCCTGGACGGGGCCGGATCGCTGCACTCGCCGTCGAAG
TCCACGCCGGTCACCGACGCCGAGGCGGGCTTGCTGCGGATGCTGGCCGCCCGCCCGGGC
CAGATCGTCTCCCGCGAGGACCTCACCGAGGCGACCGGCGGCGAGGACGTCAGCCGGGTC
ACGTCGGTGCTCAAGCAGAAGCTGCTGGACATCGACTCCGGCGCGAAGCTGCTGAAGATC
CCGCACCTGGGCTTCCGGCTGGTCGGCACGGTGCGACAGGACGCCCGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001867 Signal transduction response regulator, C-terminal (Domain)
 [141-185]  1.6e-05 PF00486
PF00486   Trans_reg_C
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [139-185]  2e-05 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
IPR016032 Signal transduction response regulator, C-terminal effector (Domain)
 [104-210]  3.99999861686541e-06 SSF46894
SSF46894   Bipartite_resp_reg_C-effector
SignalP No significant hit
TMHMM No significant hit