close all open/close all

CDS information : Pact_00100


close this sectionLocation

Organism
StrainATCC 27456 (=NBRC 13433)
Entry namePactamycin
Contig
Start / Stop / Direction13,670 / 12,534 / - [in whole cluster]
13,670 / 12,534 / - [in contig]
Locationcomplement(12534..13670) [in whole cluster]
complement(12534..13670) [in contig]
TypeCDS
Length1,137 bp (378 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)putative deacetylase
GenepctI
ptmG
Gene (GenBank)pctI
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[17827660] Cloning of the pactamycin biosynthetic gene cluster and characterization of a crucial glycosyltransferase prior to a unique cyclopentane ring formation. (J Antibiot (Tokyo). , 2007)
[19670201] Deciphering pactamycin biosynthesis and engineered production of new pactamycin analogues. (Chembiochem. , 2009)

close this sectionSequence

selected fasta
>hypothetical protein [putative deacetylase]
MTEIPDTWCPIALPHVETADGEILFMGRRITGSGRTAGEDAGLLARCDGARPLTAFPAAD
RAVLDGWLRDGVVVMAPAPARAAPGTAAAPEAPEPPRPAGTPETPEASGGPGATAAPGTP
DPSGGPAIPGTPVIVSPHPDDAALAVGGTVAREGGRFLDVFSEETWTKDPYYAERPAQTR
RLLLAEETVAARVLGAEVELLGFTDAADRELRRDRFFADKPWSDGFAREEPELFEAVTER
LAPLLAGTAPVYAPLGVGGHVDHLACRDAVVALARTGRIDPGRLRFYEDQPYSLFSSAEE
TARRLGPWLELAGLGPLDPELRPVDGTAALAKREALKAYRIQVRRGIIHRIGRHDMHLAS
QSSQSGSPAAERLWRLRG
selected fasta
>hypothetical protein [putative deacetylase]
ATGACGGAAATTCCTGACACCTGGTGCCCGATCGCGCTGCCGCACGTGGAAACGGCCGAC
GGGGAGATCCTCTTCATGGGGCGCCGGATCACCGGCTCCGGGCGGACGGCCGGCGAGGAC
GCCGGGCTGCTGGCCCGCTGCGACGGCGCCCGCCCGCTCACGGCCTTCCCCGCGGCGGAC
CGCGCGGTCCTCGACGGCTGGCTGCGGGACGGGGTGGTGGTGATGGCGCCCGCGCCCGCC
CGCGCGGCGCCCGGGACGGCGGCCGCGCCGGAGGCCCCGGAGCCGCCCCGGCCGGCGGGA
ACGCCGGAGACCCCGGAGGCGTCCGGGGGACCGGGTGCCACCGCGGCCCCCGGGACCCCG
GATCCGTCCGGCGGACCCGCGATCCCCGGCACGCCCGTGATCGTCTCCCCGCACCCGGAC
GACGCGGCGCTGGCCGTGGGCGGCACGGTGGCCCGCGAAGGCGGCCGGTTCCTCGACGTG
TTCAGCGAGGAGACCTGGACCAAGGACCCCTACTACGCCGAGCGGCCGGCGCAGACCCGG
CGCCTGCTGCTGGCCGAGGAGACCGTCGCCGCCCGGGTGCTGGGCGCCGAGGTGGAGCTG
CTGGGCTTCACCGACGCCGCCGACCGGGAGCTGAGACGGGACCGCTTCTTCGCCGACAAG
CCCTGGTCGGACGGGTTCGCCCGGGAGGAGCCGGAGCTGTTCGAGGCGGTCACCGAACGG
CTCGCCCCGCTGCTGGCGGGCACCGCCCCGGTCTACGCCCCGCTGGGCGTGGGCGGCCAC
GTGGACCACCTGGCCTGCCGGGACGCGGTGGTGGCGCTGGCCCGGACCGGCCGGATCGAC
CCGGGCCGGCTGCGCTTCTACGAGGACCAGCCGTACTCGCTGTTCTCCTCCGCCGAGGAG
ACCGCGCGCCGGCTCGGACCCTGGCTGGAGCTGGCCGGACTCGGCCCGCTCGACCCGGAA
CTGCGGCCGGTGGACGGCACCGCGGCGCTCGCCAAGCGCGAGGCGCTGAAGGCCTACCGC
ATCCAGGTCCGCCGGGGCATCATCCACCGCATCGGCCGGCATGACATGCACCTGGCGTCG
CAGTCCTCGCAGTCCGGCTCGCCGGCCGCCGAACGCCTCTGGCGGCTCCGCGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003737 N-acetylglucosaminyl phosphatidylinositol deacetylase (Family)
 [133-272]  5.6e-10 PF02585
PF02585   PIG-L
IPR024078 Putative deacetylase LmbE-like domain (Domain)
 [128-377]  2.90000354677981e-18 SSF102588
SSF102588   SSF102588
 [133-346]  8.80000000000003e-14 G3DSA:3.40.50.10320
G3DSA:3.40.50.10320   G3DSA:3.40.50.10320
SignalP
 [1-31]  0.035 Signal
Bacteria, Gram-negative   
 [1-21]  0.101 Signal
Eukaryota   
TMHMM No significant hit