close all open/close all

CDS information : Pact_00110


close this sectionLocation

Organism
StrainATCC 27456 (=NBRC 13433)
Entry namePactamycin
Contig
Start / Stop / Direction14,089 / 16,074 / + [in whole cluster]
14,089 / 16,074 / + [in contig]
Location14089..16074 [in whole cluster]
14089..16074 [in contig]
TypeCDS
Length1,986 bp (661 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.2 modification methylation
Productputative C-methyltransferase
Product (GenBank)methyltransferase
GenepctJ
ptmH
Gene (GenBank)pctJ
EC number2.1.1.-
Keyword
  • hydroxyethyl unit
Note
Note (GenBank)
Reference
ACC
PmId
[17827660] Cloning of the pactamycin biosynthetic gene cluster and characterization of a crucial glycosyltransferase prior to a unique cyclopentane ring formation. (J Antibiot (Tokyo). , 2007)
[19670201] Deciphering pactamycin biosynthesis and engineered production of new pactamycin analogues. (Chembiochem. , 2009)
[21513878] Biosynthetic studies and genetic engineering of pactamycin analogs with improved selectivity toward malarial parasites. (Chem Biol. , 2011)

close this sectionSequence

selected fasta
>putative C-methyltransferase [methyltransferase]
MAPLRGRSSPVASEGDLACRLESGGEAGMKTRVLLVQQGVWGNSVASMPLAIGYLKAYAD
ADERIRRRMDISIRNYPGDAGLNAMGRDLIRDGVPDVLCFSVLGWNFRAFGTLAETFKQV
NPDGWVIFGGNHVAHQAERVFRMFPQVDVVVNGEGELVFRDLMNGYLDGARPTALHEISG
VSFREADGNLVTTPERERIQDLEILPSPILTGAIPLADSQGRFLYDYAIMETNRGCPYKC
AFCYWGGATGQKMRAFSRERLREELDVLGRHGAEILMLADSNFGLLRQDEEFLEDLLRVR
AKYGYPNRLETSWAKNKSAGFYRIMEKMKESGMHSAFILALQTMDESVLDLMRRRNMKLN
DWESLVGWLTDHGITPYLELIWGAPGETVESFLDGYDRAARHTPFIAVHPLMLLPNTEYH
DKRQVHGLVTVRGEQDDFDYVLAHRTMTLDDNERMLRFICWNRVLARSLWLHNIWVALRE
LADVPQSRVILSFSDWVESSDDPDARELHALARPTSSASEQVDPHVWRLLTKRLLRKWWD
EAMRPDLPEALLPLLDEVFRYDLMCQPVRMLPDGSGPEEDLPVVEKYGSEWYMRDKVTFT
HPVPELIAALRRGETVSTEPRCHAVTFYYRTQFGGDLQHYFRMDRFRGLTAEQLDHQFTR
V
selected fasta
>putative C-methyltransferase [methyltransferase]
GTGGCCCCATTGCGTGGGAGATCTTCTCCTGTAGCCTCAGAAGGCGACCTGGCCTGTCGG
CTCGAATCAGGGGGCGAAGCAGGAATGAAGACCCGCGTACTACTAGTACAGCAAGGCGTC
TGGGGAAATTCCGTAGCTTCGATGCCGCTGGCGATCGGATACCTCAAAGCCTATGCCGAC
GCCGATGAACGCATCCGGCGACGCATGGACATCTCGATCCGCAACTACCCCGGCGACGCC
GGCCTCAACGCCATGGGCCGGGACCTCATCCGGGACGGGGTGCCCGACGTCCTGTGCTTC
TCCGTGCTGGGCTGGAACTTCCGCGCCTTCGGCACCCTCGCCGAGACGTTCAAGCAGGTC
AACCCGGACGGCTGGGTCATCTTCGGCGGCAACCACGTGGCCCACCAGGCGGAGCGCGTC
TTCCGGATGTTCCCGCAGGTGGACGTGGTGGTGAACGGCGAGGGCGAGCTGGTCTTCCGG
GACCTGATGAACGGCTACCTGGACGGCGCCCGCCCCACCGCGCTGCACGAGATCAGCGGC
GTGTCCTTCCGCGAGGCGGACGGCAACCTGGTCACCACGCCCGAACGCGAGCGCATTCAG
GACCTGGAGATCCTGCCGTCGCCCATTCTCACCGGCGCGATCCCGCTCGCCGACAGCCAG
GGGCGTTTCCTCTACGACTACGCCATCATGGAGACCAACCGCGGCTGCCCCTACAAGTGC
GCCTTCTGTTATTGGGGCGGCGCCACCGGGCAGAAGATGCGCGCCTTCTCCAGGGAACGG
CTCCGCGAGGAACTCGACGTTCTCGGCCGGCACGGTGCGGAAATCCTCATGCTCGCCGAC
TCCAACTTCGGACTCCTGCGCCAGGACGAGGAATTCCTCGAAGACCTCCTCCGGGTGCGT
GCCAAGTACGGCTACCCGAACCGGCTCGAAACCTCCTGGGCCAAGAACAAATCGGCCGGC
TTCTACCGCATCATGGAGAAGATGAAGGAGTCCGGGATGCACAGCGCCTTCATTCTGGCG
CTGCAGACCATGGACGAATCCGTACTGGACCTGATGCGCCGGCGGAACATGAAGCTGAAC
GACTGGGAGAGCCTGGTCGGCTGGCTGACCGATCACGGGATCACCCCTTATCTGGAACTC
ATCTGGGGCGCCCCCGGGGAGACCGTGGAGTCCTTCCTGGACGGTTATGACCGGGCCGCG
CGGCACACCCCGTTCATCGCCGTCCACCCGCTGATGCTGCTGCCCAACACCGAGTACCAC
GACAAGCGGCAGGTGCACGGCCTGGTGACCGTGCGCGGCGAACAGGACGACTTCGACTAC
GTCCTCGCGCACCGGACCATGACGCTCGACGACAACGAGCGCATGCTCCGGTTCATCTGC
TGGAACCGGGTGCTCGCCCGGAGCCTGTGGCTGCACAACATCTGGGTCGCGCTGCGCGAG
CTCGCCGACGTGCCGCAGTCCCGGGTCATCCTCAGCTTCTCCGACTGGGTGGAGAGCAGC
GACGATCCCGACGCCAGGGAGCTGCACGCGCTCGCCCGGCCCACCAGCTCCGCCAGCGAG
CAGGTCGACCCGCACGTCTGGCGGCTGCTCACCAAACGGCTGCTGCGCAAGTGGTGGGAC
GAGGCGATGCGCCCGGACCTGCCCGAGGCGCTGCTGCCGCTGCTGGACGAGGTGTTCCGC
TACGACCTGATGTGCCAGCCGGTGCGGATGCTGCCCGACGGCTCCGGTCCCGAGGAGGAC
CTGCCGGTCGTCGAGAAGTACGGCAGCGAGTGGTACATGCGGGACAAGGTCACCTTCACC
CACCCCGTCCCCGAGCTGATCGCCGCCCTGCGGCGCGGGGAGACGGTGAGCACCGAACCG
CGGTGCCACGCGGTCACCTTCTACTACCGCACGCAGTTCGGCGGCGACCTCCAGCACTAC
TTCCGGATGGACCGCTTCCGGGGGCTGACCGCCGAGCAGCTCGACCACCAGTTCACGCGC
GTTTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR006158 Cobalamin (vitamin B12)-binding (Domain)
 [90-162]  5.10000000000001e-10 PF02310
PF02310   B12-binding
 [30-173]  PS51332
PS51332   B12_BINDING
IPR006638 Elongator protein 3/MiaB/NifB (Domain)
 [226-442]  2.10000267834031e-21 SM00729
SM00729   Elp3
IPR007197 Radical SAM (Domain)
 [231-394]  1.3e-14 PF04055
PF04055   Radical_SAM
IPR023404 Radical SAM, alpha/beta horseshoe (Domain)
 [226-429]  2.80000000000001e-29 G3DSA:3.80.30.20
G3DSA:3.80.30.20   G3DSA:3.80.30.20
SignalP No significant hit
TMHMM No significant hit