close all open/close all

CDS information : Pact_00130


close this sectionLocation

Organism
StrainATCC 27456 (=NBRC 13433)
Entry namePactamycin
Contig
Start / Stop / Direction16,396 / 17,352 / + [in whole cluster]
16,396 / 17,352 / + [in contig]
Location16396..17352 [in whole cluster]
16396..17352 [in contig]
TypeCDS
Length957 bp (318 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
ProductN-glycosyltransferase
Product (GenBank)glycosyltransferase
GenepctL
ptmJ
Gene (GenBank)pctL
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[17827660] Cloning of the pactamycin biosynthetic gene cluster and characterization of a crucial glycosyltransferase prior to a unique cyclopentane ring formation. (J Antibiot (Tokyo). , 2007)
[19670201] Deciphering pactamycin biosynthesis and engineered production of new pactamycin analogues. (Chembiochem. , 2009)

close this sectionSequence

selected fasta
>N-glycosyltransferase [glycosyltransferase]
MEATPARPGGGPGDISVSVVVPTRDRTTRLLLTLAALAHQTLDRDRFEVILVDDAPERGA
VDRVLAAAPGTPPLRHARTGGRGPARARNAGAELARGELLLFLDDDTVATPELLTAHLAA
HRDAPGTVVHGTITDLSAFALTPDPPAPRPALTGARGRSIDARRVARLREDAQLLGPRRS
FIERTAAKVIRDPALAGLRWLACIGTSTSVRRADFERAGGFDEGFGELWGGEDLELGLRL
HAAGARFALLDTVAYHLPTARRDTGELLPRFWRLAAERHGDPRLADVGTFLAGRLSPEEL
AARLGTRTAALSPGRAAP
selected fasta
>N-glycosyltransferase [glycosyltransferase]
ATGGAAGCGACGCCCGCCCGGCCGGGGGGAGGTCCCGGCGACATCTCGGTGAGCGTGGTC
GTACCGACCCGGGACCGGACCACGCGTCTGCTGCTCACCCTGGCGGCGCTGGCCCACCAG
ACCCTGGACCGCGACCGGTTCGAGGTCATCCTGGTCGACGACGCGCCCGAACGCGGGGCG
GTGGACCGGGTGCTGGCCGCGGCCCCCGGGACACCGCCGCTGCGGCACGCCCGCACCGGC
GGCCGGGGGCCCGCCCGCGCCCGGAACGCCGGCGCGGAGCTGGCCCGCGGGGAGCTGCTG
CTCTTCCTCGACGACGACACCGTGGCCACCCCCGAACTGCTCACCGCGCACCTGGCGGCG
CACCGCGACGCCCCGGGCACCGTGGTGCACGGCACCATCACCGATCTGTCGGCGTTCGCG
CTGACCCCCGATCCGCCGGCCCCGCGGCCGGCGCTGACCGGTGCCCGCGGCCGCAGCATC
GACGCCCGCCGGGTGGCCCGGCTGCGCGAGGACGCCCAGCTGCTCGGGCCGCGCCGGTCG
TTCATCGAGCGGACCGCCGCCAAGGTCATCCGCGACCCGGCGCTGGCCGGCCTGCGCTGG
CTGGCGTGCATCGGCACCAGCACCAGTGTGCGGCGGGCCGACTTCGAGCGGGCCGGCGGC
TTCGACGAGGGCTTCGGGGAGCTGTGGGGCGGCGAGGACCTGGAGCTGGGGCTGCGGCTG
CACGCCGCCGGGGCCCGCTTCGCGCTGCTGGACACGGTCGCGTACCACCTGCCCACCGCC
CGCCGGGACACCGGCGAACTGCTGCCCCGGTTCTGGCGCCTGGCGGCCGAACGGCACGGC
GATCCGCGGCTGGCCGACGTCGGCACCTTCCTCGCCGGCCGGCTCTCCCCGGAGGAACTG
GCCGCCCGGCTCGGCACCCGCACCGCGGCCCTCTCCCCGGGGAGGGCCGCACCATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
No significant hit
SignalP
 [1-38]  0.296 Signal
Bacteria, Gram-positive   
TMHMM No significant hit