close all open/close all

CDS information : Pact_00140


close this sectionLocation

Organism
StrainATCC 27456 (=NBRC 13433)
Entry namePactamycin
Contig
Start / Stop / Direction17,349 / 19,037 / + [in whole cluster]
17,349 / 19,037 / + [in contig]
Location17349..19037 [in whole cluster]
17349..19037 [in contig]
TypeCDS
Length1,689 bp (562 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Productputative acyltransferase
Product (GenBank)ketoacyl-ACP synthase
GenepctM
ptmK
Gene (GenBank)pctM
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[17827660] Cloning of the pactamycin biosynthetic gene cluster and characterization of a crucial glycosyltransferase prior to a unique cyclopentane ring formation. (J Antibiot (Tokyo). , 2007)
[19670201] Deciphering pactamycin biosynthesis and engineered production of new pactamycin analogues. (Chembiochem. , 2009)
Related Reference
ACC
O34340
PmId
[11325930] Response of Bacillus subtilis to cerulenin and acquisition of resistance. (J Bacteriol. , 2001)

close this sectionSequence

selected fasta
>putative acyltransferase [ketoacyl-ACP synthase]
MTAPRAGTVVVGGTAAERLAELRSRPDLAVTAPAQSLATAFTGVLTAALAGLPAGHRRQA
PVVMAATDYAVAATSGYVARCAEAEAGGRRLRPSEAMTPEPAQLLQELAERTDWQGPGHV
LISPRSATWQAVRWAFGAVSAGLHPAMVVCEVARDPAGGGYRVAAVPVTAPGPHADPPTG
PVVISGTGLVTAFGDGADTFWRNLLAGRRGTGELTRFDAGRFRSRTVCQTTVAAAPGRPV
RRALVDRARAEALAEAGLGRLPERTLLVYAGVVPHLPAVAGAPGVGEIALEPEWDGDGFG
AAPGDRVLMAHACASGAFGLAMAREWLLCGLADTAVIVGVSALNTYDYACLDVLRATTTG
IARPFDEDRSGVTVGEGAGVIVLETAARAAARGHRPPAVLAGISCRVAGQGVSALSTRVG
AVCMREALAMAGLRTVDYVHGHAPGTRQGDEAELRALDQVGAELGWRDVPVSSCKGASGH
LLHASVFPAVVTAVRALRDGVLPGTPGLRTPLGARHVRVLRDAESREGLSSVLVDNFGFG
GNNAAFLLTGDAAGHLEWSAHG
selected fasta
>putative acyltransferase [ketoacyl-ACP synthase]
ATGACCGCACCCCGGGCCGGCACGGTGGTGGTGGGCGGCACCGCCGCCGAGCGGCTGGCC
GAACTGCGCTCCCGCCCGGACCTGGCCGTCACCGCCCCCGCCCAGTCGCTCGCCACCGCC
TTCACCGGGGTGCTCACCGCGGCGCTCGCCGGGCTGCCCGCCGGTCACCGGCGGCAGGCG
CCGGTGGTCATGGCCGCCACCGACTACGCGGTGGCGGCCACCTCCGGTTACGTCGCCCGC
TGCGCCGAGGCCGAGGCGGGCGGCCGCCGGCTGCGCCCGTCGGAGGCGATGACCCCGGAG
CCGGCCCAGCTCCTCCAGGAGCTGGCCGAACGCACCGACTGGCAGGGCCCCGGCCATGTG
CTCATCTCCCCCCGGTCGGCGACCTGGCAGGCGGTCCGCTGGGCGTTCGGCGCGGTCTCG
GCCGGCCTGCACCCGGCGATGGTGGTCTGCGAGGTGGCCCGCGACCCGGCGGGCGGCGGC
TACCGGGTGGCGGCCGTGCCGGTCACCGCACCGGGCCCGCACGCCGACCCGCCCACCGGA
CCGGTGGTGATCTCCGGCACCGGCCTGGTCACCGCGTTCGGCGACGGCGCCGACACCTTC
TGGCGGAACCTGCTCGCCGGCCGCCGGGGCACGGGCGAGCTGACCCGCTTCGACGCCGGC
CGCTTCCGCAGCCGCACCGTGTGCCAGACCACGGTGGCTGCCGCGCCCGGCCGGCCGGTG
CGGCGCGCCCTGGTGGACCGCGCCCGCGCCGAGGCGCTCGCCGAGGCCGGGCTGGGCCGG
CTGCCGGAGCGCACCCTGCTGGTGTACGCCGGGGTGGTGCCGCACCTGCCGGCGGTCGCC
GGCGCGCCCGGGGTCGGGGAGATCGCCCTGGAACCGGAGTGGGACGGCGACGGCTTCGGG
GCCGCCCCCGGGGACCGGGTGCTGATGGCGCACGCCTGCGCCTCGGGTGCCTTCGGGCTC
GCCATGGCCCGCGAATGGCTGCTGTGCGGCCTCGCCGACACCGCGGTGATCGTGGGCGTG
TCGGCCCTCAACACCTACGACTACGCCTGCCTGGACGTGCTCCGCGCCACCACCACCGGC
ATCGCCCGCCCCTTCGACGAGGACCGCTCCGGCGTGACCGTCGGGGAGGGCGCGGGGGTG
ATCGTGCTGGAGACCGCCGCCCGCGCGGCGGCCCGCGGCCACCGCCCGCCGGCCGTGCTC
GCCGGCATCTCCTGCCGGGTGGCCGGCCAGGGCGTCAGCGCGCTGAGCACCCGGGTCGGG
GCGGTGTGCATGCGCGAGGCGCTGGCGATGGCGGGCCTGCGGACCGTGGACTACGTGCAC
GGTCACGCCCCCGGCACCCGCCAGGGCGACGAGGCCGAGCTGCGGGCGCTGGACCAGGTC
GGCGCCGAGCTGGGCTGGCGGGACGTGCCGGTCAGCTCCTGCAAGGGGGCCTCCGGCCAC
CTGCTGCACGCCTCGGTGTTCCCCGCCGTGGTCACGGCGGTCCGGGCGCTGCGGGACGGG
GTGCTCCCGGGCACCCCCGGTCTGCGGACGCCCCTGGGTGCGCGGCACGTCCGCGTACTG
CGCGACGCGGAGTCCCGCGAGGGGCTGAGCTCCGTGCTGGTGGACAACTTCGGTTTCGGC
GGCAACAACGCCGCGTTCCTGCTCACCGGGGACGCGGCCGGGCACCTGGAGTGGAGTGCA
CATGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [181-226]  1.3e-05 PF00109 [310-388]  5.40000000000001e-10 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [399-506]  3.3e-18 PF02801
PF02801   Ketoacyl-synt_C
IPR016038 Thiolase-like, subgroup (Domain)
 [179-271]  5.00000000000001e-28 G3DSA:3.40.47.10 [305-402]  5.00000000000001e-28 G3DSA:3.40.47.10 [417-548]  3.3e-27 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [179-396]  1.50000306971104e-26 SSF53901 [357-548]  1e-37 SSF53901
SSF53901   Thiolase-like
SignalP
 [1-50]  0.47 Signal
Eukaryota   
TMHMM No significant hit