close all open/close all

CDS information : Pact_00160


close this sectionLocation

Organism
StrainATCC 27456 (=NBRC 13433)
Entry namePactamycin
Contig
Start / Stop / Direction20,808 / 22,544 / + [in whole cluster]
20,808 / 22,544 / + [in contig]
Location20808..22544 [in whole cluster]
20808..22544 [in contig]
TypeCDS
Length1,737 bp (578 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.3 uncharacterized protein (biosynthesis involved)
Producthypothetical protein
Product (GenBank)methyltransferase
GenepctO
ptmM
Gene (GenBank)pctO
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[17827660] Cloning of the pactamycin biosynthetic gene cluster and characterization of a crucial glycosyltransferase prior to a unique cyclopentane ring formation. (J Antibiot (Tokyo). , 2007)
[19670201] Deciphering pactamycin biosynthesis and engineered production of new pactamycin analogues. (Chembiochem. , 2009)
[21513878] Biosynthetic studies and genetic engineering of pactamycin analogs with improved selectivity toward malarial parasites. (Chem Biol. , 2011)

close this sectionSequence

selected fasta
>hypothetical protein [methyltransferase]
MSDVVLLTPREIPTGAASLNNQNVLINDEEYLSLDPAMRLFYKRVRENLGVACIAGHLRG
CGYSVRALNLHGRNPSDEVITDLIRHERPKFVGISIMYDLHIVDAVRLLRCVRAADPSVF
VAIGGAFCTYNGKLIAERIPEADCVAFGEGELTVEGLMECLAAGRDWRSVPGLWFWQDGR
VRSSGPPKLPDLSKQAWPARDVLIHHREAGIPTPRASTYTSRGCHAKCTFCYAPRQPGVE
NGPWRVRPIGDAVDEIEYLQREFGTRFLWFNDDNFGGAFQDGYHHAVGFAEEILRRGLKI
NFHCEFRVDTGLIDREALRTLRRAGMDLALLGMETGSPGMMKRFRKGTTVAYNFDAARLF
KEEGIELEPGWIMIEPGTTLDELWENLKFIVTARVHESENPFFLINRAIALRGTEIYDKA
TRYEEPDIPGVEGPAWEVLRHARRDYRVEDDRVEHLWTAWSRVSSEINDRKENEVPFLAQ
SIADAVRARRGTGAESLRPLLGRLRSWDQGLDALLIAFLNVGLLLADENPPELADRLEAQ
LRDMINAYDREHLGHTFPDFVAETARACGEHAMAQVRG
selected fasta
>hypothetical protein [methyltransferase]
ATGTCGGACGTGGTCCTGCTGACACCCCGGGAAATACCCACCGGCGCCGCGAGCCTGAAC
AACCAGAACGTGCTCATCAACGACGAGGAGTACCTGTCGCTGGACCCGGCGATGCGCCTG
TTCTACAAGCGCGTCCGGGAGAACCTGGGGGTGGCCTGCATCGCCGGCCACCTGCGCGGG
TGCGGGTACTCGGTGCGGGCGCTCAACCTGCACGGGCGCAACCCCAGCGACGAGGTCATC
ACCGACCTGATCCGCCACGAGCGGCCGAAGTTCGTGGGCATCAGCATCATGTACGACCTG
CACATCGTGGACGCGGTGCGGCTGCTGCGCTGTGTCCGGGCCGCCGATCCGTCGGTGTTC
GTGGCGATCGGCGGGGCGTTCTGCACCTACAACGGCAAGCTGATCGCCGAGCGCATCCCG
GAGGCGGACTGCGTGGCCTTCGGCGAGGGCGAGCTGACCGTCGAGGGGCTGATGGAGTGC
CTGGCCGCCGGCCGCGACTGGCGGTCGGTGCCGGGGCTGTGGTTCTGGCAGGACGGACGG
GTGCGCAGCAGCGGCCCGCCGAAGCTGCCGGACCTGTCCAAGCAGGCCTGGCCCGCCCGT
GACGTCCTGATCCACCACCGCGAGGCGGGCATCCCCACCCCGCGCGCCTCGACGTACACC
AGCCGCGGCTGCCACGCGAAGTGCACCTTCTGCTACGCGCCGCGCCAGCCCGGGGTGGAG
AACGGGCCCTGGCGGGTGCGGCCCATCGGGGACGCGGTGGACGAGATCGAGTACCTGCAG
CGGGAGTTCGGCACCCGGTTCCTGTGGTTCAACGACGACAACTTCGGCGGCGCCTTCCAG
GACGGCTACCACCACGCCGTCGGGTTCGCCGAGGAGATCCTGCGCCGCGGCCTGAAGATC
AACTTCCACTGCGAGTTCCGGGTGGACACCGGGCTGATCGACCGGGAGGCGCTGCGCACC
CTGCGCCGGGCCGGCATGGACCTGGCGCTGCTGGGCATGGAGACCGGCTCCCCGGGGATG
ATGAAGCGCTTCCGCAAGGGCACCACGGTCGCCTACAACTTCGACGCCGCCCGGCTGTTC
AAGGAGGAGGGCATCGAGCTGGAGCCCGGCTGGATCATGATCGAGCCCGGCACCACCCTC
GACGAGCTGTGGGAGAACCTGAAGTTCATCGTCACCGCCCGGGTGCACGAGAGCGAGAAC
CCGTTCTTCCTGATCAACCGGGCCATCGCACTGCGGGGCACGGAGATCTACGACAAGGCC
ACCCGGTACGAGGAGCCGGACATCCCCGGCGTCGAGGGCCCCGCCTGGGAGGTGCTGCGG
CACGCCCGCCGCGACTACCGGGTCGAGGACGACCGGGTGGAGCACCTGTGGACGGCGTGG
AGCCGGGTCTCCTCGGAGATCAACGACCGCAAGGAGAACGAGGTCCCGTTCCTCGCCCAG
AGCATCGCGGACGCGGTGCGCGCCCGCCGCGGCACCGGCGCCGAGTCGCTGCGCCCGCTG
CTGGGCCGGCTGCGCAGCTGGGACCAGGGCCTGGACGCGCTGCTGATCGCCTTCCTCAAC
GTCGGGCTGCTGCTGGCGGACGAGAACCCGCCGGAGCTGGCCGACCGGCTGGAGGCCCAG
CTGCGCGACATGATCAACGCCTACGACCGGGAGCACCTGGGCCACACCTTCCCGGACTTC
GTGGCCGAGACCGCGCGGGCGTGCGGTGAGCACGCCATGGCACAGGTGAGGGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR006158 Cobalamin (vitamin B12)-binding (Domain)
 [50-131]  3.1e-05 G3DSA:3.40.50.280
G3DSA:3.40.50.280   B12_bd
 [33-168]  PS51332
PS51332   B12_BINDING
 [49-187]  1.59999889349252e-10 SSF52242
SSF52242   Cbl-bd
 [45-157]  3.3e-19 PF02310
PF02310   B12-binding
IPR006638 Elongator protein 3/MiaB/NifB (Domain)
 [214-440]  5.59999989417023e-20 SM00729
SM00729   Elp3
IPR007197 Radical SAM (Domain)
 [219-390]  1.4e-14 PF04055
PF04055   Radical_SAM
IPR023404 Radical SAM, alpha/beta horseshoe (Domain)
 [214-470]  4.9e-31 G3DSA:3.80.30.20
G3DSA:3.80.30.20   G3DSA:3.80.30.20
SignalP
 [1-18]  0.132 Signal
Eukaryota   
TMHMM No significant hit