close all open/close all

CDS information : Pact_00170


close this sectionLocation

Organism
StrainATCC 27456 (=NBRC 13433)
Entry namePactamycin
Contig
Start / Stop / Direction22,548 / 23,603 / + [in whole cluster]
22,548 / 23,603 / + [in contig]
Location22548..23603 [in whole cluster]
22548..23603 [in contig]
TypeCDS
Length1,056 bp (351 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productputative oxidoreductase
Product (GenBank)putative NAD dependent dehydrogenase
GenepctP
ptmN
Gene (GenBank)pctP
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[17827660] Cloning of the pactamycin biosynthetic gene cluster and characterization of a crucial glycosyltransferase prior to a unique cyclopentane ring formation. (J Antibiot (Tokyo). , 2007)
[19670201] Deciphering pactamycin biosynthesis and engineered production of new pactamycin analogues. (Chembiochem. , 2009)
Related Reference
ACC
Q2I8V6
PmId
[16461673] Catabolism of 1,5-anhydro-D-fructose in Sinorhizobium morelense S-30.7.5: discovery, characterization, and overexpression of a new 1,5-anhydro-D-fructose reductase and its application in sugar analysis and rare sugar synthesis. (Appl Environ Microbiol. , 2006)
Family/Domain
FD
IPR000683, IPR004104

close this sectionSequence

selected fasta
>putative oxidoreductase [putative NAD dependent dehydrogenase]
MTREKPIRFAAVGAGRVFQRYHLPCVDARDDVELVGLVDADADRAASVAAGRPGVWTGTD
VARLIREARPDALSVCTPNDAHAAPVLAALDAGIPVLCEKPLAATVDEARRMAEHPAAAE
LLAVNMPFRCHSLTAPFAEAAGKGAQRVEVSFVTPGNRVWRACTPWYGDARRAGGGALLD
LGPHAIDLLMTVFGHPDVEACTVNAEGVEEQAELQLSFQGLPATIRIDRAARRMETAVTV
TTADGAHVLDLRRNELRLADGTVRQGADRPELAAISAFFDAVTGAATGAAGAAGDGPAAG
GAAGTSGADAAGAGATGVTGAGAVGAREALAVQLVVDEAYRRARGAAPAVT
selected fasta
>putative oxidoreductase [putative NAD dependent dehydrogenase]
ATGACCCGCGAGAAGCCGATCCGGTTCGCCGCGGTGGGGGCCGGGCGGGTGTTCCAGCGC
TACCACCTGCCCTGCGTCGACGCCCGGGACGACGTGGAACTGGTGGGGCTGGTGGACGCC
GACGCGGACCGGGCGGCGTCCGTCGCGGCCGGCCGGCCGGGGGTGTGGACCGGCACCGAC
GTCGCGCGGCTGATCCGCGAGGCCCGGCCGGACGCGCTCAGCGTCTGCACCCCCAACGAC
GCCCACGCCGCGCCGGTGCTGGCCGCGCTGGACGCCGGTATCCCGGTGCTCTGCGAGAAA
CCCCTGGCCGCCACGGTGGACGAGGCGCGGCGGATGGCCGAGCACCCGGCCGCGGCGGAG
CTGCTGGCGGTGAACATGCCGTTCCGCTGCCACTCGCTGACCGCGCCGTTCGCCGAGGCG
GCCGGCAAGGGCGCGCAGCGGGTGGAGGTCTCCTTCGTCACCCCCGGCAACCGGGTGTGG
CGGGCCTGCACCCCCTGGTACGGCGACGCCCGGCGGGCCGGCGGCGGCGCCCTGCTGGAC
CTCGGTCCGCACGCCATCGACCTGCTGATGACCGTCTTCGGCCATCCGGACGTCGAGGCG
TGCACGGTGAACGCCGAGGGGGTGGAGGAACAGGCCGAGCTCCAACTGTCCTTCCAGGGC
CTGCCGGCCACGATCCGGATCGACCGGGCCGCCCGCCGGATGGAGACCGCGGTGACCGTC
ACCACGGCCGACGGCGCGCACGTGCTGGACCTGCGGCGCAACGAGCTGCGGCTCGCCGAC
GGCACCGTCCGGCAGGGCGCCGACCGCCCGGAACTCGCCGCGATCTCCGCGTTCTTCGAC
GCGGTGACCGGCGCGGCGACCGGCGCGGCGGGGGCCGCTGGGGACGGCCCGGCGGCTGGC
GGTGCGGCCGGCACGTCCGGAGCGGATGCGGCCGGTGCGGGCGCGACCGGTGTGACCGGG
GCGGGGGCGGTGGGCGCCCGGGAGGCGCTCGCGGTCCAGCTCGTCGTGGACGAGGCCTAC
CGCCGCGCCCGGGGCGCGGCCCCGGCGGTGACCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000683 Oxidoreductase, N-terminal (Domain)
 [7-119]  1.1e-25 PF01408
PF01408   GFO_IDH_MocA
IPR004104 Oxidoreductase, C-terminal (Domain)
 [165-199]  2.3e-05 PF02894
PF02894   GFO_IDH_MocA_C
IPR016040 NAD(P)-binding domain (Domain)
 [2-177]  1.5e-33 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP
 [1-28]  0.154 Signal
Eukaryota   
TMHMM No significant hit