close all open/close all

CDS information : Pact_00180


close this sectionLocation

Organism
StrainATCC 27456 (=NBRC 13433)
Entry namePactamycin
Contig
Start / Stop / Direction24,687 / 23,914 / - [in whole cluster]
24,687 / 23,914 / - [in contig]
Locationcomplement(23914..24687) [in whole cluster]
complement(23914..24687) [in contig]
TypeCDS
Length774 bp (257 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Productputative hydrolase
Product (GenBank)hydrolase
GenepctQ
ptmO
Gene (GenBank)pctQ
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[17827660] Cloning of the pactamycin biosynthetic gene cluster and characterization of a crucial glycosyltransferase prior to a unique cyclopentane ring formation. (J Antibiot (Tokyo). , 2007)
[19670201] Deciphering pactamycin biosynthesis and engineered production of new pactamycin analogues. (Chembiochem. , 2009)
Related Reference
ACC
Q83WC8
PmId
[12542698] Role of Acinetobacter calcoaceticus 3,4-dihydrocoumarin hydrolase in oxidative stress defence against peroxoacids. (Eur J Biochem. , 2003)

close this sectionSequence

selected fasta
>putative hydrolase [hydrolase]
MLRDRDQSNRWSGPAEGPPLPLSCRVTGEPDGKPVVLLHALGNTGRDWAPLITALAPLGR
RLYVPDLRGHGASPRSERYTFELMYRDVVALLDRYRLDTVDLVGHSMGGHIGWLIAQRQP
ARVRRLVIEDTPPPPRDAAAEEEMRLRSAREDDRAPVISLYQEFRDLRRSGGLDSAAVRP
IIDELRRADPGWWRRLAEVTAETLVISGGLSSPVPRSLLAEVAGRVPHGRLLAIDAGHYV
HRTEPERFCAEVVRFLS
selected fasta
>putative hydrolase [hydrolase]
GTGCTGCGCGACCGGGACCAGTCGAACAGATGGAGCGGTCCGGCGGAAGGGCCGCCGCTG
CCGCTGAGTTGCCGGGTCACCGGCGAGCCGGACGGGAAGCCGGTGGTGCTGCTGCACGCC
CTCGGCAACACCGGCCGGGACTGGGCCCCGCTGATCACCGCGCTGGCCCCGCTGGGCCGT
CGGCTCTACGTACCGGATCTGCGCGGACACGGCGCCAGCCCCCGGTCCGAGCGCTACACC
TTCGAGCTGATGTACCGGGACGTCGTCGCCCTGCTCGACCGGTACCGGCTGGACACCGTG
GACCTGGTGGGGCACTCGATGGGCGGGCACATCGGCTGGCTGATCGCCCAGCGGCAGCCC
GCCCGGGTGCGCCGGCTGGTGATCGAGGACACGCCCCCGCCGCCCCGGGACGCGGCGGCC
GAGGAGGAGATGCGCCTGCGGTCGGCGCGGGAGGACGACCGGGCCCCGGTCATCTCGCTC
TACCAGGAGTTCCGCGACCTGCGCCGGTCCGGCGGGCTGGACAGCGCCGCGGTACGGCCG
ATCATCGACGAGCTGCGGCGGGCCGACCCCGGCTGGTGGCGGCGGCTGGCGGAGGTCACC
GCCGAGACGCTGGTGATCAGCGGCGGCCTCTCCAGCCCGGTGCCCCGGTCGCTGCTGGCC
GAGGTCGCCGGCCGGGTCCCGCACGGCCGGCTGCTGGCCATCGACGCCGGGCACTATGTG
CACCGTACCGAGCCGGAACGGTTCTGCGCCGAGGTCGTACGGTTCCTGAGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000073 Alpha/beta hydrolase fold-1 (Domain)
 [59-74]  1.40000045763982e-06 PR00111 [102-115]  1.40000045763982e-06 PR00111 [116-129]  1.40000045763982e-06 PR00111
PR00111   ABHYDROLASE
SignalP No significant hit
TMHMM No significant hit