close all open/close all

CDS information : Pact_00190


close this sectionLocation

Organism
StrainATCC 27456 (=NBRC 13433)
Entry namePactamycin
Contig
Start / Stop / Direction24,797 / 25,432 / + [in whole cluster]
24,797 / 25,432 / + [in contig]
Location24797..25432 [in whole cluster]
24797..25432 [in contig]
TypeCDS
Length636 bp (211 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Productputative phosphotransferase
Product (GenBank)phosphopantetheinyl transferase
GenepctR
ptmP
Gene (GenBank)pctR
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[17827660] Cloning of the pactamycin biosynthetic gene cluster and characterization of a crucial glycosyltransferase prior to a unique cyclopentane ring formation. (J Antibiot (Tokyo). , 2007)
[19670201] Deciphering pactamycin biosynthesis and engineered production of new pactamycin analogues. (Chembiochem. , 2009)
Family/Domain
FD
IPR003542

close this sectionSequence

selected fasta
>putative phosphotransferase [phosphopantetheinyl transferase]
MILFATAAVAAPYGPREQHLAGRAAAADALRRAGSTRLTVGRRGDGAPCFPPGFTGSITH
TRRLAVAVVCRAGEVRGIGVDLETDPVPGRLHRILLGEEERAALWTPADETTLRGLFVAK
EAAFKAFSAGGERATRMFWRIRLERPDPGPEPPGAVCGTSDPASGASPSRGASTGSGTWL
VARAGRERARVRVRTGRELAWAVAVLPAPAP
selected fasta
>putative phosphotransferase [phosphopantetheinyl transferase]
GTGATCCTCTTCGCCACCGCGGCCGTCGCCGCGCCGTACGGGCCCCGGGAGCAGCACCTG
GCCGGCCGTGCGGCGGCGGCCGACGCGCTGCGCCGGGCCGGCAGCACCCGGCTGACGGTG
GGCCGGCGGGGTGACGGGGCGCCGTGCTTCCCGCCCGGTTTCACCGGCTCCATCACCCAC
ACCCGGCGGCTGGCCGTGGCGGTGGTGTGCCGGGCCGGGGAGGTGCGGGGGATCGGGGTG
GACCTGGAGACCGACCCGGTGCCCGGCCGCCTGCACCGCATCCTGCTCGGCGAGGAGGAG
CGCGCGGCGCTGTGGACGCCCGCCGACGAGACCACCCTGCGCGGCCTCTTCGTCGCCAAG
GAGGCGGCGTTCAAGGCGTTCTCGGCGGGCGGGGAGCGGGCGACGCGGATGTTCTGGCGG
ATCCGGCTGGAGCGGCCGGACCCGGGGCCGGAGCCTCCCGGCGCCGTGTGCGGTACGTCG
GACCCGGCGTCCGGCGCGTCGCCGTCCCGCGGGGCGTCCACCGGTTCCGGGACGTGGCTG
GTGGCCCGCGCCGGCCGGGAGCGGGCCCGGGTCCGGGTCCGGACCGGCCGCGAACTGGCC
TGGGCGGTGGCCGTCCTGCCGGCCCCGGCTCCATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003542 Enterobactin synthetase-like, component D (Family)
 [13-33]  3.99999861686541e-06 PR01399 [43-61]  3.99999861686541e-06 PR01399 [115-131]  3.99999861686541e-06 PR01399
PR01399   ENTSNTHTASED
IPR008278 4'-phosphopantetheinyl transferase (Domain)
 [77-148]  1.8e-06 PF01648
PF01648   ACPS
 [76-137]  5.3e-07 G3DSA:3.90.470.20
G3DSA:3.90.470.20   G3DSA:3.90.470.20
SignalP
 [1-26]  0.196 Signal
Bacteria, Gram-positive   
 [1-10]  0.463 Signal
Bacteria, Gram-negative   
TMHMM No significant hit