close all open/close all

CDS information : Pact_00200


close this sectionLocation

Organism
StrainATCC 27456 (=NBRC 13433)
Entry namePactamycin
Contig
Start / Stop / Direction31,973 / 26,388 / - [in whole cluster]
31,973 / 26,388 / - [in contig]
Locationcomplement(26388..31973) [in whole cluster]
complement(26388..31973) [in contig]
TypeCDS
Length5,586 bp (1,861 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
6-methylsalicylic acid synthase
Product (GenBank)iterative type I PKS
GenepctS
ptmQ
Gene (GenBank)pctS
EC number2.3.1.165
Keyword
  • iterative
  • 6-methylsalicylic acid
Note
Note (GenBank)
Reference
ACC
PmId
[17827660] Cloning of the pactamycin biosynthetic gene cluster and characterization of a crucial glycosyltransferase prior to a unique cyclopentane ring formation. (J Antibiot (Tokyo). , 2007)
[19670201] Deciphering pactamycin biosynthesis and engineered production of new pactamycin analogues. (Chembiochem. , 2009)
[21513878] Biosynthetic studies and genetic engineering of pactamycin analogs with improved selectivity toward malarial parasites. (Chem Biol. , 2011)
Related Reference
ACC
Q0R4P8
NITE
Chth_00060
PmId
[16793515] Genetic characterization of the chlorothricin gene cluster as a model for spirotetronate antibiotic biosynthesis. (Chem Biol. , 2006)
[16677607] Cloning and characterization of a bacterial iterative type I polyketide synthase gene encoding the 6-methylsalicyclic acid synthase. (Biochem Biophys Res Commun. , 2006)
[20534347] Insights into bacterial 6-methylsalicylic acid synthase and its engineering to orsellinic acid synthase for spirotetronate generation. (Chem Biol. , 2010)
[26833898] Insights into 6-Methylsalicylic Acid Bio-assembly by Using Chemical Probes. (Angew Chem Int Ed Engl. , 2016)
ACC
P87162
PmId
[20304931] Hidden function of catalytic domain in 6-methylsalicylic acid synthase for product release. (J Biol Chem. , 2010)
ACC
P22367
PmId
[26833898] Insights into 6-Methylsalicylic Acid Bio-assembly by Using Chemical Probes. (Angew Chem Int Ed Engl. , 2016)

close this sectionPKS/NRPS Module

1 acetyl-CoA
malonyl-CoA
KS62..436
AT642..957
TH965..1129
KR1502..1695
ACP1779..1856

close this sectionSequence

selected fasta
>polyketide synthase [iterative type I PKS]
MSAAKDGHRSEADGSRQVPEGTAGAGQVTYGTDGTDRAAGTRQVTHGTDGAAGTRPAAHG
ADEPVAIIGMSCRFPGGADSPDAFWELLAQGRDGIRDGSARWAAYAAAGHEHAAVVRRTT
GFGGFLDDIAGFDAEFFGISPREAELMDPQQRLLLELAWEALEHAGLPPLELAGGDCGVF
VGVGSDDYGRRLLEDLPRIEPWTGIGASMCATANRVSHSLDLRGPSLAVDTACSASLVAV
HLACRSLLAGESEVALAAGVNLMVAPGLSVTLDRAGATSPDGRSKPFDAAADGYGRGEGA
GVVVLKRLADAERAGDPVLAVIRGTGVSQDGRTDGIMAPSGEAQADLLRRTYRRCGIAPG
TVDYVEAHGTGTVAGDPLEAGALGAVFGAGRPADRPCLIGSVKGNIGHLEAGSGIAGVIK
TVLALGREEIPPSVHFSAPNPRIPWETARLRVATGRTPWPRGDGPRRAGVSSFGYGGTIA
HVVLEEAPAPAPGRAPAPEPAVGAEGAVGTERAVVTEPAPAAGPAPAAGPAAASGPAAAP
EAAGAEAGPPSLLFPLSARSREAVRADAARLADWLDGPGAGAAPASLAHTLGVRRSHLEH
RVAVVARDRAELAARLRHVAAGEAAPGVTEGTVVEGAGTGVVWVFSGTGAQWPGMGRELL
ATEPAFAAVIDRIDPVYAAEIGTTARRMIQEGDVSRVDVAQAMIFAVQAGLTAVWTSLGV
RPAAVVGHSLGEIAAAVAAGVLSVEDGARLVCRRSVLLRRVAGAGGMLLVGLSAEEATDR
LGTADDVVPAVLASPTSTVLSGPVARIDALAREWSADPELLVRRVDSEVAFHSPQMDPLL
DELARAAAPLTVHPPAVPIYGTALADPRDPAPRGGAYWAANLRNPVRLAGAVAAAAEDGF
RAFLEISAHPVVGHSVQETLDAAGAAGHCVAGSLRRDAGGRDQLLLNAGLLYCHGAAPDR
AAFPDGELLALPPRTWRRRTYWRDLPARREDRGRHDPAGRTLLGPRTVLAGATPLHLWRT
RVDMETRPYPGHHTIQGTEIVPAAVVLQTFLDATGTGPGPRGLTGVDFALPLTLEPARDI
DVTAQDGVVRLLSRPAATGTDSDTGRGPEGGGSDAGPDGGEREWLTHASASAAEDLTPPD
AAPPAGGPGTVLPPDRAHADLAAVGVPTMAFPWEVTRLERLPDGLRAEVTAADGPEGTPD
GWAPLLDAALSVAAVAFPGTPALRVVAGVSRVWTAGGAPDRARIEARVTGPVTEAAGTVD
VTLVAADGRTVAVLAGVRYAGAAADQPRAAEPEELLYATEWHPLTVDPADLPLPPRPLVL
VGPAEGPGPALRARCTETGRRVALLADPDGLDPLLDRAGGPVDVLVLPVAAEPAEPAADR
AVREAWLLARTARRLAARPPGQARLWSLTVGVREAAGADSVAQAARWGLGRIIGGEHPDL
WGGTLDLAPDHTAADLATALDVSAAGPGEDVVAVRGGRAEANRLVRCAAPPARPPLRCRA
DGSYLITGGLGGLGGEIARRLVELGARRLVLAGRSALPPRSAWDTVTDPEQARRIATVRR
LEALGATVRVVALDIADAGAAAAALDPDALDLPPIRGVVHAAGVTDDRLVEQLDRDALAA
VIRPKAAGAFTLHRLFPPGSLDFVVHFSSCGQLLGLTGQGAYAAANAFLDAVAGYERAAG
SAGSMSLAWTSWRGIGLADNAAVDAELAAHGVGDVTVPEALAAWDHAARLGLPSLAVLRT
VPLPEGTRRTGLLRDVTDPEPATPAPGGAAAGAGIDGLSGEELRAALRERTAALIVGEMR
WDPAGLDPDRSLLKMGMDSVMAIVIRRKLEQLLGRKLPANLVWHQQTVSNIVDYLVTTSR
P
selected fasta
>polyketide synthase [iterative type I PKS]
GTGAGCGCGGCCAAGGACGGGCACCGGTCGGAGGCGGACGGCAGCCGGCAGGTGCCGGAG
GGTACGGCCGGCGCCGGGCAGGTCACGTACGGCACGGACGGTACGGACAGGGCGGCCGGC
ACCCGGCAGGTCACGCACGGCACGGACGGCGCGGCCGGCACCCGGCCGGCAGCGCACGGC
GCCGACGAGCCCGTCGCGATCATCGGGATGAGCTGCCGGTTCCCCGGCGGCGCGGACTCC
CCCGACGCCTTCTGGGAGCTGCTGGCGCAGGGCCGGGACGGCATCCGGGACGGTTCCGCG
CGGTGGGCGGCGTACGCGGCGGCGGGACACGAGCACGCCGCGGTGGTGCGCCGGACCACC
GGGTTCGGCGGCTTCCTCGACGACATCGCCGGGTTCGACGCCGAGTTCTTCGGCATCTCG
CCGCGCGAGGCGGAGCTGATGGACCCGCAGCAGCGGCTGCTGCTGGAGCTGGCCTGGGAG
GCGCTGGAGCACGCGGGGCTGCCGCCGCTGGAGCTGGCCGGCGGCGACTGCGGGGTCTTC
GTGGGCGTCGGGTCGGACGACTACGGGCGCCGGCTGCTGGAGGACCTGCCCCGGATCGAG
CCGTGGACCGGCATCGGCGCCTCGATGTGCGCCACCGCGAACCGCGTCTCGCACAGCCTG
GACCTGCGCGGTCCCAGCCTGGCGGTGGACACCGCCTGCTCGGCGTCGCTGGTCGCCGTG
CACCTGGCGTGCCGGAGCCTGCTGGCCGGGGAGTCGGAGGTGGCGCTGGCCGCGGGGGTC
AACCTCATGGTGGCCCCCGGGCTGTCGGTGACCCTGGACCGGGCGGGCGCCACCTCCCCG
GACGGCCGCAGCAAGCCGTTCGACGCGGCGGCCGACGGCTACGGCCGCGGTGAGGGCGCG
GGCGTGGTGGTGCTGAAGCGGCTGGCGGACGCGGAGCGGGCGGGTGACCCGGTGCTGGCC
GTCATCCGCGGCACCGGGGTGAGCCAGGACGGCCGTACCGACGGGATCATGGCGCCCAGC
GGCGAGGCCCAGGCGGACCTGCTGCGGCGGACGTACCGGCGGTGCGGCATCGCGCCCGGC
ACGGTCGACTACGTGGAGGCGCACGGGACCGGCACGGTGGCCGGCGACCCGCTGGAGGCG
GGGGCGCTCGGCGCGGTGTTCGGCGCGGGCCGGCCCGCGGACCGGCCCTGTCTGATCGGC
TCGGTGAAGGGCAACATCGGTCACCTGGAGGCGGGTTCCGGGATCGCCGGGGTGATCAAG
ACGGTGCTCGCCCTGGGCCGGGAGGAGATCCCGCCCAGCGTCCACTTCTCCGCCCCCAAC
CCCCGTATCCCGTGGGAGACCGCGCGGCTGCGGGTGGCCACCGGACGCACCCCCTGGCCG
CGCGGCGACGGGCCCCGCCGGGCGGGCGTGTCCAGCTTCGGTTACGGCGGCACCATCGCC
CATGTCGTCCTGGAGGAGGCCCCGGCCCCCGCCCCGGGACGCGCCCCCGCCCCGGAGCCG
GCCGTCGGCGCGGAAGGGGCCGTCGGCACGGAACGGGCCGTCGTCACGGAACCGGCTCCC
GCCGCGGGACCGGCTCCCGCCGCGGGACCGGCCGCGGCCTCCGGACCGGCCGCCGCCCCG
GAGGCCGCGGGCGCCGAGGCCGGGCCACCGTCCCTGCTCTTCCCGCTCTCCGCCCGGTCG
CGGGAGGCGGTGCGGGCGGACGCCGCCCGGCTCGCCGACTGGCTGGACGGGCCCGGCGCC
GGCGCCGCGCCGGCCTCGCTCGCGCACACCCTCGGGGTCCGGCGCAGCCATCTGGAGCAC
CGGGTCGCGGTGGTCGCCCGGGACCGCGCGGAACTCGCCGCCCGGCTGCGCCACGTCGCC
GCCGGCGAGGCCGCGCCCGGGGTCACCGAGGGCACGGTGGTGGAGGGCGCGGGGACCGGC
GTGGTGTGGGTGTTCTCCGGCACCGGTGCCCAGTGGCCCGGCATGGGCCGCGAACTGCTC
GCCACCGAGCCCGCGTTCGCCGCCGTGATCGACCGGATCGACCCGGTCTACGCCGCGGAG
ATCGGCACCACCGCGCGCCGGATGATCCAGGAGGGGGACGTCTCCCGGGTGGACGTGGCC
CAGGCCATGATCTTCGCGGTGCAGGCGGGGCTGACCGCCGTCTGGACGTCGCTCGGCGTC
CGGCCGGCGGCCGTGGTGGGCCACTCGCTGGGCGAGATCGCCGCCGCGGTGGCCGCCGGG
GTGCTCTCCGTGGAGGACGGGGCGCGGCTGGTCTGCCGCCGCAGCGTGCTGCTGCGTCGG
GTGGCCGGCGCGGGCGGCATGCTGCTGGTGGGGCTCTCCGCCGAGGAGGCCACCGACCGT
CTCGGCACGGCGGACGACGTGGTGCCGGCCGTCCTCGCCTCACCCACCAGCACGGTGCTC
TCCGGCCCGGTGGCCCGGATCGACGCCCTGGCCCGCGAGTGGTCGGCGGACCCGGAGCTG
CTGGTGCGGCGGGTGGACAGCGAGGTGGCGTTCCACAGCCCGCAGATGGACCCGCTGCTC
GACGAACTGGCCCGGGCGGCGGCCCCGCTGACCGTCCACCCGCCGGCCGTGCCGATCTAC
GGCACCGCGCTGGCCGACCCGCGCGACCCGGCCCCGCGGGGCGGCGCCTACTGGGCGGCG
AACCTGCGCAACCCGGTCCGGCTGGCCGGCGCGGTCGCCGCGGCGGCCGAGGACGGCTTC
CGCGCCTTCCTGGAGATCTCGGCCCACCCGGTGGTGGGCCACTCGGTGCAGGAGACGCTC
GACGCGGCCGGCGCCGCCGGCCACTGTGTCGCCGGCAGCCTCCGCCGGGACGCCGGGGGC
CGGGACCAGCTGCTGCTCAACGCCGGTCTGCTGTACTGCCACGGCGCCGCGCCGGACCGG
GCCGCGTTCCCGGACGGGGAGCTGCTGGCGCTGCCGCCCCGGACCTGGCGGCGCCGCACG
TACTGGCGCGACCTGCCGGCCCGGCGGGAGGACCGGGGGCGGCACGACCCGGCCGGCCGG
ACCCTGCTGGGGCCGCGCACCGTCCTGGCCGGGGCGACCCCGCTGCACCTGTGGCGGACC
CGGGTGGACATGGAGACCCGGCCCTACCCCGGGCACCACACCATCCAGGGCACCGAGATC
GTGCCGGCGGCGGTGGTGCTCCAGACGTTCCTGGACGCCACCGGAACCGGCCCGGGCCCG
CGGGGCCTGACCGGGGTGGACTTCGCCCTGCCGCTGACCCTGGAGCCGGCCCGGGACATC
GACGTCACCGCGCAGGACGGGGTGGTGCGGCTGCTGTCCCGGCCGGCCGCGACCGGCACC
GACAGCGACACCGGCCGCGGACCGGAGGGCGGCGGGTCGGACGCCGGCCCGGACGGCGGG
GAGCGGGAGTGGCTGACGCACGCCTCGGCGTCGGCGGCCGAGGACCTGACACCGCCGGAC
GCGGCGCCGCCGGCCGGCGGGCCGGGCACGGTTCTGCCGCCCGACCGGGCGCACGCCGAC
CTGGCCGCGGTCGGCGTACCGACCATGGCCTTCCCCTGGGAGGTGACCCGGCTGGAGCGG
CTGCCGGACGGGCTGCGCGCCGAGGTGACCGCCGCCGACGGGCCGGAGGGGACACCGGAC
GGCTGGGCCCCGCTGCTGGACGCCGCGCTCTCCGTCGCCGCGGTCGCCTTCCCCGGCACC
CCGGCGCTGCGGGTCGTGGCCGGGGTGTCCCGGGTGTGGACGGCGGGCGGTGCGCCGGAC
CGCGCCCGGATCGAGGCGCGGGTGACCGGCCCGGTCACCGAGGCCGCCGGCACGGTGGAC
GTGACCCTGGTGGCCGCGGACGGGCGGACCGTCGCGGTGCTGGCCGGGGTCCGGTACGCG
GGGGCGGCGGCAGACCAGCCCCGGGCCGCCGAGCCGGAGGAGCTGCTGTACGCGACCGAG
TGGCACCCGCTCACCGTGGACCCCGCCGACCTGCCGCTGCCGCCCCGGCCGCTGGTGCTG
GTCGGCCCCGCCGAGGGGCCGGGCCCGGCGCTGCGGGCGCGGTGCACGGAGACCGGCCGG
CGGGTGGCGCTACTGGCCGACCCGGACGGGCTGGACCCGCTGCTCGACCGGGCCGGCGGC
CCGGTGGACGTGCTGGTGCTGCCCGTCGCGGCGGAACCGGCGGAACCGGCCGCGGACCGC
GCGGTACGGGAGGCGTGGCTGCTGGCCCGCACCGCGCGGCGGCTCGCCGCCCGGCCGCCC
GGACAGGCCCGGCTGTGGTCGCTGACCGTGGGCGTCCGGGAGGCGGCCGGCGCCGACTCG
GTGGCCCAGGCGGCCCGCTGGGGGCTGGGCCGGATCATCGGCGGGGAGCACCCCGACCTG
TGGGGCGGCACCCTCGACCTGGCCCCCGACCACACCGCCGCGGACCTGGCCACCGCGCTG
GACGTGTCGGCCGCGGGCCCCGGCGAGGACGTGGTGGCGGTCCGCGGCGGCCGGGCCGAG
GCCAACCGGCTGGTGCGCTGCGCCGCGCCGCCGGCCCGCCCGCCGCTGCGGTGCCGGGCC
GACGGCAGCTACCTGATCACCGGTGGACTGGGCGGACTGGGCGGCGAGATCGCCCGCCGG
CTGGTGGAGCTGGGCGCCCGCCGGCTGGTGCTCGCCGGGCGCTCCGCGCTGCCGCCGCGC
TCGGCGTGGGACACGGTCACCGATCCGGAACAGGCCCGCCGGATCGCGACCGTCCGCCGG
CTGGAGGCGCTCGGCGCCACGGTGCGGGTGGTCGCCCTGGACATCGCCGACGCCGGGGCG
GCGGCCGCCGCCCTGGACCCGGACGCCCTGGACCTGCCGCCGATCCGCGGCGTGGTGCAC
GCGGCCGGCGTGACCGACGACCGGCTGGTGGAGCAGCTCGACCGGGACGCCCTCGCCGCG
GTGATCCGCCCCAAGGCCGCCGGGGCGTTCACCCTGCACCGGCTCTTCCCGCCCGGCAGC
CTCGACTTCGTGGTGCACTTCTCGTCCTGCGGCCAGCTGCTCGGACTCACCGGGCAGGGC
GCCTACGCGGCGGCCAACGCGTTCCTGGACGCGGTGGCCGGATACGAGCGGGCCGCCGGG
TCGGCCGGCAGCATGAGCCTGGCGTGGACCTCGTGGCGCGGGATCGGCCTCGCCGACAAC
GCGGCGGTGGACGCCGAACTCGCCGCCCACGGGGTCGGGGACGTCACGGTGCCGGAGGCG
CTGGCCGCCTGGGACCACGCCGCCCGGCTCGGCCTGCCCTCGCTGGCGGTCCTGCGGACC
GTGCCGCTGCCGGAGGGCACCCGCCGCACCGGCCTGCTGCGGGACGTCACCGACCCCGAG
CCGGCCACCCCGGCACCCGGCGGGGCGGCGGCGGGCGCGGGGATCGACGGGCTGTCCGGG
GAGGAGCTCCGGGCAGCGCTGCGGGAGCGGACCGCCGCCCTGATCGTCGGGGAGATGCGG
TGGGACCCGGCCGGACTGGACCCGGACCGGTCGCTGCTGAAGATGGGCATGGACTCGGTC
ATGGCGATCGTCATCCGGCGGAAGCTGGAGCAACTGCTGGGCCGCAAACTCCCGGCCAAC
CTCGTCTGGCACCAGCAGACGGTGTCCAACATCGTGGACTACCTGGTCACCACGTCCCGC
CCCTGA
[1] KS62..436
[1] AT642..957
[1] acetyl-CoA malonyl-CoA829..833
[1] TH965..1129
[1] KR1502..1695
[1] ACP1779..1856
[1] KS184..1308
[1] AT1924..2871
[1] acetyl-CoA malonyl-CoA2485..2499
[1] TH2893..3387
[1] KR4504..5085
[1] ACP5335..5568

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [639-761]  2.70000000000002e-62 G3DSA:3.40.366.10 [829-945]  2.70000000000002e-62 G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR009081 Acyl carrier protein-like (Domain)
 [1780-1858]  1.69999922284049e-13 SSF47336
SSF47336   ACP_like
 [1803-1855]  2.5e-07 PF00550
PF00550   PP-binding
 [1779-1856]  PS50075
PS50075   ACP_DOMAIN
 [1786-1857]  4.6e-11 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
IPR013968 Polyketide synthase, KR (Domain)
 [1502-1694]  5.00000000000001e-56 PF08659
PF08659   KR
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [62-311]  3.99999999999998e-86 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [319-436]  9.09999999999992e-42 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [642-957]  1.9e-88 PF00698
PF00698   Acyl_transf_1
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [640-938]  7.49999605851445e-60 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [763-828]  1.49999977583352e-10 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
IPR016038 Thiolase-like, subgroup (Domain)
 [62-322]  9.80000000000012e-96 G3DSA:3.40.47.10 [323-489]  1.6e-62 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [55-489]  3.49999466863949e-97 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [1503-1710]  2.2e-31 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [224-240]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [644-938]  6.69996745106047e-90 SM00827
SM00827   PKS_AT
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [65-489]  SM00825
SM00825   PKS_KS
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [1502-1695]  3.89999861795218e-52 SM00822
SM00822   PKS_KR
SignalP No significant hit
TMHMM No significant hit