close all open/close all

CDS information : Pact_00210


close this sectionLocation

Organism
StrainATCC 27456 (=NBRC 13433)
Entry namePactamycin
Contig
Start / Stop / Direction33,046 / 31,970 / - [in whole cluster]
33,046 / 31,970 / - [in contig]
Locationcomplement(31970..33046) [in whole cluster]
complement(31970..33046) [in contig]
TypeCDS
Length1,077 bp (358 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Productputative 6-methylsalicylyltransferase
Product (GenBank)ketoacyl-ACP synthase
GenepctT
ptmR
Gene (GenBank)pctT
EC number
Keyword
  • 6-methylsalicylic acid
Note
Note (GenBank)
Reference
ACC
PmId
[17827660] Cloning of the pactamycin biosynthetic gene cluster and characterization of a crucial glycosyltransferase prior to a unique cyclopentane ring formation. (J Antibiot (Tokyo). , 2007)
Related Reference
ACC
B7TWM5
PmId
[19670201] Deciphering pactamycin biosynthesis and engineered production of new pactamycin analogues. (Chembiochem. , 2009)
ACC
Q0R4P5
NITE
Chth_00090
PmId
[19266533] Dissection of two acyl-transfer reactions centered on acyl-S-carrier protein intermediates for incorporating 5-chloro-6-methyl-O-methylsalicyclic acid into chlorothricin. (Chembiochem. , 2009)
Conflict
Sequence
H (295..295)
Comment
conflict with B7TWM6 (delete)

close this sectionSequence

selected fasta
>putative 6-methylsalicylyltransferase [ketoacyl-ACP synthase]
MRTPGIFLAATGAYLPERTSVEDAVRRGWYERERMESCGWRNVAVADGISAPDMAVAAVR
QAVARSGLSRDDIDLLVHSCAYHQGPDGWSAPHYILRATLGTPVPALTVEQGCNAFLAAL
EMATQYLLCAPTRSGAVVSAADNFGAPSVDRWHAHRDSVLADAGAAVVLSKRSGWAELRA
VESVSLPQFEILNRGHAPIFPPALTLGKKLDMNEHLEAMVAELGPRASEIVEEYGASGTK
LVEQVASEAGITVPDLSHVLHLGAATTDFLDSHLRPMGLDASLGSVEFFRDVGHHAGAAD
VGIHLDHLACSGRLAAGDHLLMLSAGPGLMITAAVVTVLETPASHTAAPADDEGSGAW
selected fasta
>putative 6-methylsalicylyltransferase [ketoacyl-ACP synthase]
GTGAGAACACCGGGCATTTTCCTGGCAGCGACCGGGGCGTACCTCCCCGAGCGGACCAGC
GTGGAGGACGCGGTGCGGCGCGGCTGGTACGAGCGGGAACGGATGGAGTCCTGCGGCTGG
CGGAACGTCGCCGTGGCCGACGGGATATCGGCACCGGACATGGCCGTGGCCGCGGTGCGG
CAGGCGGTGGCACGCTCCGGCCTGAGCCGGGACGACATCGACCTGCTGGTGCACTCGTGC
GCCTACCACCAGGGGCCGGACGGCTGGTCGGCCCCGCACTACATCCTCCGCGCCACCCTG
GGCACCCCGGTCCCGGCGCTCACCGTGGAACAGGGGTGCAACGCGTTCCTGGCCGCGCTG
GAGATGGCCACCCAGTACCTGCTGTGCGCGCCGACGCGCAGCGGTGCCGTGGTGAGCGCC
GCCGACAACTTCGGGGCCCCGTCGGTGGACCGCTGGCACGCGCACCGGGACTCGGTGCTC
GCCGACGCGGGCGCCGCGGTGGTGCTCTCCAAGCGGTCCGGCTGGGCGGAGCTGCGGGCG
GTGGAGTCGGTCTCGCTGCCGCAGTTCGAGATCCTCAACCGCGGGCACGCCCCGATCTTC
CCGCCGGCGCTCACCCTCGGGAAGAAGCTCGACATGAACGAGCACCTGGAGGCGATGGTC
GCGGAACTGGGCCCCCGGGCGTCGGAGATCGTCGAGGAGTACGGCGCGAGCGGCACCAAG
CTGGTGGAGCAGGTGGCGAGCGAGGCCGGGATCACCGTGCCGGACCTGTCCCACGTGCTC
CACCTGGGGGCGGCCACCACCGACTTCCTCGACAGCCACCTGCGGCCGATGGGCCTGGAC
GCCTCGCTCGGGTCGGTGGAGTTCTTCCGCGACGTGGGCCACCACGCGGGCGCCGCCGAC
GTCGGCATCCACCTCGACCACCTGGCCTGCTCCGGGCGGCTGGCCGCGGGCGACCACCTG
CTGATGCTCAGCGCCGGCCCGGGACTGATGATCACCGCCGCGGTGGTGACGGTGCTGGAG
ACGCCCGCGTCCCACACGGCGGCACCGGCGGACGACGAGGGGAGCGGCGCGTGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR013747 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III C-terminal (Domain)
 [248-337]  8.5e-10 PF08541
PF08541   ACP_syn_III_C
IPR013751 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III (Domain)
 [109-172]  1.5e-05 PF08545
PF08545   ACP_syn_III
IPR016038 Thiolase-like, subgroup (Domain)
 [3-166]  5.00000000000001e-21 G3DSA:3.40.47.10 [167-174]  4.6e-14 G3DSA:3.40.47.10 [207-337]  4.6e-14 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [3-341]  4.19999771339581e-21 SSF53901
SSF53901   Thiolase-like
SignalP No significant hit
TMHMM No significant hit