close all open/close all

CDS information : Pact_00220


close this sectionLocation

Organism
StrainATCC 27456 (=NBRC 13433)
Entry namePactamycin
Contig
Start / Stop / Direction34,577 / 33,060 / - [in whole cluster]
34,577 / 33,060 / - [in contig]
Locationcomplement(33060..34577) [in whole cluster]
complement(33060..34577) [in contig]
TypeCDS
Length1,518 bp (505 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Productputative carboxylic acid--CoA ligase
putative acyl-CoA synthetase
Product (GenBank)putative AMP-forming acyl-CoA synthetase
GenepctU
ptmS
Gene (GenBank)pctU
EC number6.2.1.-
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[17827660] Cloning of the pactamycin biosynthetic gene cluster and characterization of a crucial glycosyltransferase prior to a unique cyclopentane ring formation. (J Antibiot (Tokyo). , 2007)
Related Reference
ACC
Q9LAR4
PmId
[1847615] Purification and properties of malonyl-CoA synthetase from Rhizobium japonicum. (Biochem J. , 1991)
[10871057] Identification of active-site residues in Bradyrhizobium japonicum malonyl-coenzyme A synthetase. (Arch Biochem Biophys. , 2000)
ACC
B7TWM6
PmId
[19670201] Deciphering pactamycin biosynthesis and engineered production of new pactamycin analogues. (Chembiochem. , 2009)
Conflict
Sequence
A (306..306)
Comment
conflict with B7TWM6 (G)

close this sectionSequence

selected fasta
>putative carboxylic acid--CoA ligase [putative AMP-forming acyl-CoA synthetase]
MTSARAELLARLRDRAARLGDAPLVVAGDTVTGARELLARTEAKVRALGELGVGPGALVG
TVAGPPAEFISDVFAIIEAGGVAVPLSRKLTRWELDRLQEGCPLDFLAAPPESPLTLAGP
VTGCGDRALSRGPGRIRPAFAEAATAQLTSGTTGRPRVALRPAAALLAEADHYRDALRLT
PRTTLLCPVPLQHAYGFGLCALAAPLAGAPVRQLPPDRPRMLLRELAAGDVALFVGVPPM
LRLLAKSARGPVPAGRPVGFLSAGMALDAHTAEQVAVRLGGNVGEVYGTTETGPICVRAP
RPWRPALRRPGVPLPGVKVTLAPVPGDAPEAGAGTGSGDATRADATGPRDATGPGAGPGA
GTGLVTVESPSMMLGYADGDAVDTGPSRGGFTTGDLARWEGDDLVLAGRLSTCINVAGAK
VSPEEVEAVLLAWPEVASCLVTGVPDPVLGQRVSATVTPETVDLAALDRFCRERLSDSRT
PHTFAAVAELPTTETGKVIRPRNDQ
selected fasta
>putative carboxylic acid--CoA ligase [putative AMP-forming acyl-CoA synthetase]
ATGACCTCCGCCCGCGCGGAGCTGCTCGCCCGGCTCCGGGACCGGGCCGCCCGGCTCGGT
GACGCCCCGCTGGTGGTGGCGGGCGACACCGTCACCGGCGCCCGGGAGCTGCTGGCCCGG
ACCGAGGCCAAGGTCCGGGCCCTCGGCGAGCTGGGCGTGGGGCCGGGCGCCCTGGTGGGC
ACCGTGGCCGGACCGCCGGCCGAGTTCATCAGCGATGTGTTCGCGATCATCGAGGCCGGC
GGGGTGGCCGTCCCGCTCTCCCGCAAGCTCACCCGGTGGGAGCTGGACCGGCTCCAGGAG
GGCTGCCCGCTCGACTTCCTGGCCGCGCCGCCCGAATCGCCGCTCACCCTCGCCGGCCCG
GTCACCGGGTGCGGGGACCGGGCGCTGAGCCGGGGGCCGGGGCGTATCCGGCCGGCGTTC
GCCGAGGCCGCCACCGCGCAGCTCACCTCGGGCACCACCGGCCGGCCGCGGGTGGCGCTG
CGCCCGGCCGCCGCCCTGCTCGCGGAGGCGGACCACTACCGTGACGCGCTGCGGCTGACC
CCCAGGACCACGCTGCTGTGCCCGGTGCCGCTCCAGCACGCCTACGGGTTCGGGCTGTGC
GCGCTGGCCGCCCCGCTGGCCGGCGCGCCGGTCCGCCAGCTGCCGCCGGACCGGCCGCGG
ATGCTGCTGCGGGAGCTGGCCGCCGGGGACGTGGCGCTCTTCGTCGGGGTGCCGCCGATG
CTGCGGCTGCTGGCGAAGTCGGCCCGCGGCCCGGTGCCCGCCGGGCGCCCGGTCGGGTTC
CTCTCCGCCGGGATGGCGCTGGACGCGCACACCGCCGAACAGGTCGCGGTGCGGCTCGGC
GGGAACGTCGGCGAGGTGTACGGGACCACCGAGACCGGGCCGATCTGTGTCCGGGCCCCC
CGGCCGTGGCGGCCGGCCCTGCGGCGGCCCGGCGTACCGCTGCCCGGGGTGAAGGTCACC
CTGGCGCCGGTTCCGGGGGACGCGCCGGAGGCCGGGGCCGGAACGGGGTCCGGGGACGCG
ACGAGGGCCGATGCGACGGGGCCCCGGGACGCGACGGGGCCCGGAGCCGGGCCCGGGGCC
GGGACGGGGCTGGTGACCGTGGAGTCGCCGTCGATGATGCTCGGTTACGCGGACGGGGAC
GCGGTCGACACCGGCCCGTCGCGCGGCGGGTTCACCACCGGTGACCTGGCCCGGTGGGAG
GGGGACGACCTGGTCCTGGCCGGGCGGCTGTCCACCTGCATCAACGTCGCCGGCGCGAAG
GTCAGTCCGGAGGAGGTGGAGGCGGTCCTGCTCGCCTGGCCGGAGGTCGCCTCCTGCCTG
GTGACCGGCGTACCGGATCCGGTCCTGGGGCAGCGCGTCAGCGCCACGGTGACCCCGGAG
ACGGTGGACCTCGCCGCGCTGGACCGCTTCTGCCGGGAGCGTCTGTCGGACTCCCGGACC
CCCCACACCTTCGCCGCCGTGGCGGAACTGCCGACGACCGAGACCGGGAAGGTCATCAGG
CCGCGGAACGATCAGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000873 AMP-dependent synthetase/ligase (Domain)
 [35-326]  2.90000000000001e-28 PF00501 [358-441]  4.6e-12 PF00501
PF00501   AMP-binding
SignalP No significant hit
TMHMM No significant hit