close all open/close all

CDS information : Pact_00230


close this sectionLocation

Organism
StrainATCC 27456 (=NBRC 13433)
Entry namePactamycin
Contig
Start / Stop / Direction35,908 / 34,574 / - [in whole cluster]
35,908 / 34,574 / - [in contig]
Locationcomplement(34574..35908) [in whole cluster]
complement(34574..35908) [in contig]
TypeCDS
Length1,335 bp (444 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Productaminotransferase/dehydratase
Product (GenBank)aminotransferase
GenepctV
ptmT
Gene (GenBank)pctV
EC number
Keyword
  • 3-aminoacetophenone
Note
Note (GenBank)
Reference
ACC
PmId
[17827660] Cloning of the pactamycin biosynthetic gene cluster and characterization of a crucial glycosyltransferase prior to a unique cyclopentane ring formation. (J Antibiot (Tokyo). , 2007)
[19670201] Deciphering pactamycin biosynthesis and engineered production of new pactamycin analogues. (Chembiochem. , 2009)
[23744829] A single PLP-dependent enzyme PctV catalyzes the transformation of 3-dehydroshikimate into 3-aminobenzoate in the biosynthesis of pactamycin. (Chembiochem. , 2013)
[26426567] Mechanism-Based Trapping of the Quinonoid Intermediate by Using the K276R Mutant of PLP-Dependent 3-Aminobenzoate Synthase PctV in the Biosynthesis of Pactamycin. (Chembiochem. , 2015)

close this sectionSequence

selected fasta
>aminotransferase/dehydratase [aminotransferase]
MGANDADRPTNAESLDGIKSVIAGGVSSSMRAAAVPLPLVVRSAGGCLLRDVEDGEIIDL
NMGYGPHLFGYADREVLDAVADQFAKGHMTGLPHELDARAGALIAELVPGVEQVRFANSG
TEAVASALRLARATTGRTLVVTFEGHYHGWSETVLRAGKTALHMEGTRPTDVVPGALGMI
PEALAHTVQLGWNDPDALRELFARDGDRIAAVIVEPVLANAGVIPPAPGFLQLLRELTGR
SGAMLVFDEVITGFRVARGGAQERYGVEPDLTVLSKVMGGGFPVAAFGGRRHAMRMLASN
EAHHAGVYAGNHAALRAVVAMLGKIRSLPDLYERLEDTGQYMEDTVREVFATEKRPVHIN
RVGTLMSVALLKGSAEPSAEPRDLRQLAALVDFPRHRRLQTLAQKEGVYFHPNALEPWFL
STAHTRDVIDKVAGALQRSLVGLG
selected fasta
>aminotransferase/dehydratase [aminotransferase]
GTGGGTGCCAACGATGCCGACCGCCCGACGAATGCCGAGTCCCTTGACGGCATAAAAAGC
GTCATCGCCGGCGGAGTGAGCAGCAGCATGCGCGCCGCGGCGGTTCCATTGCCGCTGGTC
GTACGGAGCGCCGGCGGTTGCCTGCTCCGCGACGTGGAGGACGGCGAGATCATCGACCTC
AACATGGGGTACGGGCCCCATCTGTTCGGCTACGCCGACCGGGAGGTCCTCGACGCGGTG
GCCGACCAGTTCGCCAAGGGCCACATGACCGGACTGCCGCACGAGCTGGACGCCCGGGCC
GGCGCGCTCATCGCCGAGCTGGTGCCGGGTGTGGAGCAGGTCAGGTTCGCCAACTCCGGT
ACCGAGGCCGTGGCGTCCGCGCTGCGGCTGGCCCGCGCCACCACCGGCCGCACCCTGGTC
GTCACCTTCGAGGGCCACTACCACGGCTGGAGCGAAACGGTCCTGCGGGCCGGCAAGACC
GCGCTGCACATGGAGGGCACCCGGCCCACCGACGTCGTCCCCGGCGCGCTGGGGATGATC
CCGGAGGCGCTCGCCCACACCGTGCAGCTCGGCTGGAACGACCCGGACGCGCTGCGGGAG
CTGTTCGCCCGGGACGGCGACCGGATCGCGGCGGTCATCGTGGAGCCGGTGCTGGCCAAC
GCCGGGGTGATCCCGCCGGCGCCCGGCTTCCTCCAGCTGCTGCGGGAGCTGACCGGGCGC
AGCGGCGCGATGCTCGTCTTCGACGAGGTGATCACCGGCTTCCGGGTGGCCCGCGGCGGG
GCACAGGAACGGTACGGCGTCGAGCCCGACCTGACCGTGCTCTCCAAGGTGATGGGCGGC
GGTTTCCCGGTGGCCGCGTTCGGCGGGCGCCGGCACGCCATGCGGATGCTGGCCAGCAAC
GAGGCGCACCACGCGGGCGTCTACGCGGGCAACCACGCCGCGCTGCGGGCGGTGGTCGCC
ATGCTCGGCAAGATACGTTCCCTGCCCGATCTGTACGAACGGCTGGAGGACACCGGGCAG
TACATGGAGGACACCGTGCGCGAGGTGTTCGCCACCGAGAAGCGGCCGGTGCACATCAAC
CGGGTCGGCACCCTGATGTCGGTGGCCCTCCTGAAGGGGTCGGCCGAGCCCTCCGCCGAA
CCCCGTGACCTGCGGCAGCTCGCCGCGCTCGTCGACTTCCCCCGGCACCGCCGCCTCCAG
ACGCTGGCGCAGAAGGAGGGCGTGTACTTCCACCCCAACGCGCTGGAGCCGTGGTTCCTG
AGCACCGCGCACACCCGCGACGTCATCGACAAGGTCGCCGGGGCGCTGCAGCGGTCCCTG
GTCGGACTCGGATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR005814 Aminotransferase class-III (Family)
 [245-281]  PS00600
PS00600   AA_TRANSFER_CLASS_3
 [41-370]  8.00000000000001e-60 PF00202
PF00202   Aminotran_3
IPR015421 Pyridoxal phosphate-dependent transferase, major region, subdomain 1 (Domain)
 [75-325]  7.79999999999999e-71 G3DSA:3.40.640.10
G3DSA:3.40.640.10   PyrdxlP-dep_Trfase_major_sub1
IPR015422 Pyridoxal phosphate-dependent transferase, major region, subdomain 2 (Domain)
 [9-74]  1e-24 G3DSA:3.90.1150.10 [330-440]  1e-24 G3DSA:3.90.1150.10
G3DSA:3.90.1150.10   PyrdxlP-dep_Trfase_major_sub2
IPR015424 Pyridoxal phosphate-dependent transferase, major domain (Domain)
 [8-440]  2.19999900980707e-94 SSF53383
SSF53383   PyrdxlP-dep_Trfase_major
SignalP No significant hit
TMHMM No significant hit