close all open/close all

CDS information : Pact_00240


close this sectionLocation

Organism
StrainATCC 27456 (=NBRC 13433)
Entry namePactamycin
Contig
Start / Stop / Direction36,153 / 36,908 / + [in whole cluster]
36,153 / 36,908 / + [in contig]
Location36153..36908 [in whole cluster]
36153..36908 [in contig]
TypeCDS
Length756 bp (251 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productputative oxidoreductase
Product (GenBank)putative short-chain dehydrogenase/reductase
GenepctW
ptmU
Gene (GenBank)pctW
EC number
Keyword
Note
  • The N-terminal position was modified from original INSDC entry.
Note (GenBank)
Reference
ACC
PmId
[17827660] Cloning of the pactamycin biosynthetic gene cluster and characterization of a crucial glycosyltransferase prior to a unique cyclopentane ring formation. (J Antibiot (Tokyo). , 2007)
[19670201] Deciphering pactamycin biosynthesis and engineered production of new pactamycin analogues. (Chembiochem. , 2009)
Related Reference
ACC
Q988B7
PmId
[16824480] Identification of a new tetrameric pyridoxal 4-dehydrogenase as the second enzyme in the degradation pathway for pyridoxine in a nitrogen-fixing symbiotic bacterium, Mesorhizobium loti. (Arch Biochem Biophys. , 2006)
ACC
Q9F5J1
PmId
[11959542] Biosynthetic gene cluster of simocyclinone, a natural multihybrid antibiotic. (Antimicrob Agents Chemother. , 2002)
[12115055] Cloning and analysis of the simocyclinone biosynthetic gene cluster of Streptomyces antibioticus Tu 6040. (Arch Microbiol. , 2002)
Family/Domain
FD
IPR002198

close this sectionSequence

selected fasta
>putative oxidoreductase [putative short-chain dehydrogenase/reductase]
MSSRRAVAVVTGAGSGLGAAVALRLAATHDLVLTHLTEDDALAETAGRAAAAGARVLATV
PGDLTDRRTVDRLEARMAEHAEHLDVLVCNAGAYRYVPWPETSWEDIRAAVEVNLLAHIA
CIHAATPHLVARGMGRIVAISTVLTQLGRVELAPYIAAKGGLESLVRALARELGPHGITV
NAVRPGSIELSVEQRRHPDYPTWRQREFARQCIKRHGRPEDVAAAVAFLVSPEAGFITGQ
SLTVDGGWDLN
selected fasta
>putative oxidoreductase [putative short-chain dehydrogenase/reductase]
ATGTCGTCTCGCCGAGCCGTCGCCGTGGTCACCGGGGCGGGGTCGGGACTGGGCGCCGCC
GTCGCGCTGCGGCTGGCCGCCACCCATGACCTGGTACTGACCCATCTGACCGAGGACGAC
GCGCTCGCCGAGACCGCCGGGCGGGCCGCGGCGGCCGGCGCCCGGGTGCTGGCCACCGTC
CCCGGTGACCTCACCGACCGGCGGACCGTGGACCGGCTCGAAGCGCGGATGGCCGAACAC
GCCGAACACCTCGACGTCCTGGTGTGCAACGCGGGCGCCTACCGTTACGTGCCCTGGCCG
GAAACCTCCTGGGAGGACATCCGGGCGGCCGTGGAAGTCAATCTGCTGGCGCATATCGCG
TGCATACACGCCGCAACCCCGCATTTGGTGGCACGCGGAATGGGCCGCATCGTCGCGATT
TCCACGGTTCTCACCCAACTCGGACGGGTGGAACTCGCGCCGTACATTGCCGCGAAGGGT
GGACTGGAGTCACTCGTTCGTGCGCTGGCTCGCGAACTCGGGCCGCACGGCATTACAGTG
AATGCCGTTCGACCAGGGTCGATCGAGCTGAGTGTGGAACAAAGGCGCCACCCGGATTAT
CCCACCTGGCGGCAGCGCGAGTTCGCGCGGCAGTGCATCAAACGCCACGGGCGCCCGGAA
GATGTCGCGGCGGCGGTGGCCTTTCTGGTTTCCCCGGAGGCCGGATTCATCACGGGCCAG
AGTCTGACCGTGGACGGCGGGTGGGATCTCAACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002198 Short-chain dehydrogenase/reductase SDR (Family)
 [82-93]  3.7e-07 PR00080 [135-143]  3.7e-07 PR00080 [155-174]  3.7e-07 PR00080
PR00080   SDRFAMILY
IPR002347 Glucose/ribitol dehydrogenase (Family)
 [7-24]  3.5e-34 PR00081 [82-93]  3.5e-34 PR00081 [129-145]  3.5e-34 PR00081 [155-174]  3.5e-34 PR00081 [176-193]  3.5e-34 PR00081 [212-232]  3.5e-34 PR00081
PR00081   GDHRDH
IPR016040 NAD(P)-binding domain (Domain)
 [7-249]  1.6e-66 G3DSA:3.40.50.720
G3DSA:3.40.50.720   no description
SignalP No significant hit
TMHMM
 [7-26]  Transmembrane (i-o)
Transmembrane 1